KEGG   Mus musculus (mouse): 19224Help
Entry
19224             CDS       T01002                                 

Gene name
Ptgs1, COX1, Cox-1, Cox-3, PGHS-1, PHS_1, Pghs1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Platelet activation
Serotonergic synapse
Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    19224 (Ptgs1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    19224 (Ptgs1)
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    19224 (Ptgs1)
  Nervous system
   04726 Serotonergic synapse
    19224 (Ptgs1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     19224 (Ptgs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
2 B; 2 24.19 cM
AA seq 602 aa AA seqDB search
MSRRSLSLWFPLLLLLLLPPTPSVLLADPGVPSPVNPCCYYPCQNQGVCVRFGLDNYQCD
CTRTGYSGPNCTIPEIWTWLRNSLRPSPSFTHFLLTHGYWLWEFVNATFIREVLMRLVLT
VRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDVQLLA
QQLLLRREFIPAPQGTNILFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNL
ERQYHLRLFKDGKLKYQVLDGEVYPPSVEQASVLMRYPPGVPPERQMAVGQEVFGLLPGL
MLFSTIWLREHNRVCDLLKEEHPTWDDEQLFQTTRLILIGETIKIVIEEYVQHLSGYFLQ
LKFDPELLFRAQFQYRNRIAMEFNHLYHWHPLMPNSFQVGSQEYSYEQFLFNTSMLVDYG
VEALVDAFSRQRAGRIGGGRNFDYHVLHVAVDVIKESREMRLQPFNEYRKRFGLKPYTSF
QELTGEKEMAAELEELYGDIDALEFYPGLLLEKCQPNSIFGESMIEMGAPFSLKGLLGNP
ICSPEYWKPSTFGGDVGFNLVNTASLKKLVCLNTKTCPYVSFRVPDYPGDDGSVLVRRST
EL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaaggagtctctcgctctggtttcccctgctgctgctcctgctgctgccgccg
acaccctcggtcctgctcgcagatcctggggtgccctcaccagtcaatccctgttgttac
tatccgtgccagaaccagggtgtctgtgtccgctttggcctcgacaactaccagtgtgat
tgtactcgcacgggctactcaggccccaactgtaccatccctgagatctggacctggctt
cggaattctctgcggcccagcccctcgttcacccatttcctgctgacacatggatactgg
ctctgggaatttgtgaatgccaccttcatccgagaagtactcatgcgcctggtactcaca
gtgcggtccaaccttatccccagccctccgacctacaactcagcgcatgactacatcagc
tgggagtccttctccaatgtgagctactatactcgcattctgccctctgtacccaaagac
tgccccacacccatggggaccaaagggaagaaacagttaccagatgttcagcttctggcc
caacagctgctgctgagaagggagttcattcctgccccccagggcaccaacatcctgttt
gccttctttgcacaacacttcacccaccagttcttcaagacctctggaaagatgggtcct
ggctttaccaaggccttaggccacggggtagaccttggccacatttatggagataatctg
gaacgacagtatcacctgcggctcttcaaggatgggaaacttaagtaccaggtgctggac
ggagaggtgtacccaccttccgtggaacaggcgtccgtgttgatgcgctacccaccaggt
gtcccgcctgaaaggcagatggctgtgggccaggaggtgtttgggttgcttccggggctg
atgctcttctccacgatctggcttcgtgaacataaccgcgtgtgcgacctgctgaaggag
gagcatcccacgtgggatgatgagcagctcttccagaccactcgcctcatccttatagga
gaaaccatcaaaattgtcattgaggagtatgtgcagcacttgagtggctatttcctgcag
ctcaagtttgacccggagctgctgttccgagcccagttccaatatcgaaaccgcatcgcc
atggaatttaaccatctctatcactggcatccactcatgcccaactccttccaagtgggc
tcacaagagtacagctacgagcagtttttatttaacacttctatgctggtggactatggg
gttgaggcactggtggatgccttctctcgccagagggctggccggattggtggaggtagg
aactttgactatcatgttctgcatgtggctgtggatgtcatcaaggagtcccgagagatg
cgcctacagcccttcaatgaataccgaaagaggtttggcttgaagccttacacctctttc
caggagctcacaggagagaaggagatggctgctgagttggaggagctgtacggtgacatc
gatgctttagagttctacccggggttgctgctggagaagtgccagcccaactccatcttt
ggagaaagtatgatagagatgggggctcccttttccctcaagggcctcctagggaatccc
atctgttccccagagtactggaaacccagcacgttcggtggtgacgtgggcttcaacctt
gtcaacacagcctcactgaagaaactggtctgcctcaacaccaagacctgcccctatgtt
tccttccgtgtgccagattaccctggagatgacgggtctgtcttagtgagacgctccact
gagctctga

DBGET integrated database retrieval system