Mus musculus (house mouse): 20292 Help Entry 20292             CDS       T01002                                  Symbol Ccl11, Scya11, eotaxin Name (RefSeq) C-C motif chemokine ligand 11   KO K16597   C-C motif chemokine 11 Organism mmu  Mus musculus (house mouse) Pathway mmu04060   Cytokine-cytokine receptor interaction mmu04061   Viral protein interaction with cytokine and cytokine receptor mmu04062   Chemokine signaling pathway mmu04657   IL-17 signaling pathway mmu05310   Asthma Brite KEGG Orthology (KO) [BR:mmu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     20292 (Ccl11)    04061 Viral protein interaction with cytokine and cytokine receptor     20292 (Ccl11)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     20292 (Ccl11)    04062 Chemokine signaling pathway     20292 (Ccl11)  09160 Human Diseases   09163 Immune disease    05310 Asthma     20292 (Ccl11)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mmu04052]     20292 (Ccl11) Cytokines and neuropeptides [BR:mmu04052]  Cytokines   Chemokines    20292 (Ccl11) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  20292 NCBI-ProteinID:  NP_035460 MGI:  103576 Ensembl:  ENSMUSG00000020676 UniProt:  P48298 LinkDB All DBs Position 11:81948658..81953781 Genome browser AA seq 97 aa AA seqDB search MQSSTALLFLLLTVTSFTSQVLAHPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLK AIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgcagagctccacagcgcttctattcctgctgctcacggtcacttccttcacctcccag gtgctggctcacccaggctccatcccaacttcctgctgctttatcatgaccagtaagaag atccccaacacactactgaagagctacaaaagaatcaccaacaacagatgcaccctgaaa gccatagtcttcaagaccaggttgggcaaagagatctgtgctgaccccaagaagaagtgg gtccaggatgccacaaagcacctggaccaaaaactccaaactccaaaaccataa

DBGET integrated database retrieval system