KEGG   Mus musculus (mouse): 239017Help
Entry
239017            CDS       T01002                                 

Gene name
Ogdhl
Definition
(RefSeq) oxoglutarate dehydrogenase-like
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mmu  Mus musculus (mouse)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Tryptophan metabolism
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    239017 (Ogdhl)
  Amino acid metabolism
   00310 Lysine degradation
    239017 (Ogdhl)
   00380 Tryptophan metabolism
    239017 (Ogdhl)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     239017 (Ogdhl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
UniProt: 
LinkDB All DBs
Position
14; 14 B
AA seq 1029 aa AA seqDB search
MSQLRLLPFRLGPRATKLLATRAIPVFSGCRRSSGPPTTIPRSRSGVSSSYVEEMYFAWL
ENPQSVHKSWDSFFQRASKEASVGPAQPQLPAVLQESRTSVSSCTKTSKLVEDHLAVQSL
IRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTIDKLGKSWDPSLLSFYAALASFPAF
YDLQEADLDKEFRLPTTTFIGGPENTLSLREIIRRLESTYCQHIGLEFMFINDVEQCQWI
RQKFETPGVMQFSVEEKRTLLARLVRSMRFEDFLARKWSSEKRFGLEGCEVMIPALKTII
DKSSEMGIENVILGMPHRGRLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMY
HERINRVTNRNITLSLVANPSHLEAVDPVVQGKTKAEQFYRGDAQGRKVMSILVHGDAAF
AGQGVVYETFHLSDLPSYTTNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFH
VNADDPEAVIYVCSVAAEWRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHKQV
PVLKKYADKLIAEGTVTLQEFEEEIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFN
VDGEPKSMTCPTTGIPEEMLTHIGSVASSVPLEDFKIHTGLSRILRGRADMTKKRTVDWA
LAEYMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHDQEVDRRTCVPMNHLWPDQAPYT
VCNSSLSEYGVLGFELGYAMASPNALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNG
IVLLLPHGMEGMGPEHSSARPERFLQMSNDDSDAYPVFTEDFEVSQLYDCNWIVVNCSTP
ASYFHVLRRQILLPFRKPLIVFTPKSLLRHPDAKSSFDQMVSGTSFQRLIPEDGPAAHSP
EQVQRLIFCTGKVYYDLVKERSSQGLEQQVAITRLEQISPFPFDLIMREAEKYSGAELVW
CQEEHKNMGYYDYISPRFMTLLGHSRPIWYVGRDPAAAPATGNKNAHLVSLRRFLDTAFN
LKAFEGKTF
NT seq 3090 nt NT seq  +upstreamnt  +downstreamnt
atgagccagctgaggctgctgccattccggctggggccacgggccaccaagctcctggcc
acacgggctatcccggtgttcagtgggtgcaggaggtcttctggaccaccaacgaccatc
ccgaggagcagaagcggagtcagctccagttatgtggaagagatgtactttgcctggttg
gaaaacccacagagcgttcacaagtcctgggacagcttttttcagagagcaagtaaggag
gcctctgtgggtcctgctcagccgcagctcccagctgttctccaagaaagcaggacatca
gtgtcaagctgcaccaagaccagcaagctggtggaagaccacttggcagtccagtccctg
atccgggcctaccagatccgaggccaccatgtggcccagctggaccccctgggcatcctg
gatgcagacctagattcctttgtgccctctgacttgatcacaaccattgataaattgggt
aagagttgggatccttcccttctttctttctatgctgccttggcctcttttccagccttc
tatgacctgcaggaggctgatctggataaggagttccggctgcccaccacgactttcatc
gggggcccagagaacacactctctcttcgagagatcatacgtcgcttggagagcacctac
tgccagcatattggcctggagttcatgtttattaatgacgtggaacagtgccagtggatc
agacagaaatttgaaactcctggcgtgatgcagttttccgtcgaggagaagaggaccctg
ctggctagactggtgcgctccatgaggtttgaagacttcctggccaggaagtggtcttcg
gagaagcggtttggcctggaaggctgcgaggtcatgattcctgctctcaagaccattatc
gacaagtctagtgagatggggattgagaacgtcatcctggggatgccacacaggggcagg
ctgaatgtgctggctaacgtgatccgcaaggacctggaacagatcttctgtcagtttgat
cccaagctggaagcagcagatgagggctctggtgatgtcaaataccatctgggcatgtac
cacgagaggatcaaccgtgtcaccaacaggaacatcacattgtcactggtagccaaccct
tcccatctagaagctgtggaccccgtggtacagggcaagacgaaggcagagcagttctac
cgtggggatgcccagggtaggaaggtcatgtctatcctggtccatggggatgccgccttc
gctggccagggggtcgtctatgagaccttccatctcagtgacctgccttcttataccacc
aatggcacagtgcacgttgtggtcaacaaccagatcggcttcaccacagatccccgaatg
gctcgctcctccccttaccccactgatgtggcgcgggtggtcaatgcacccatcttccat
gtgaacgcagacgacccagaggctgtgatctatgtgtgcagtgtggcagctgagtggagg
aacaccttcaacaaagatgttgttgtagacctggtctgttaccgccggcgtggtcacaat
gagatggacgagcccatgttcacgcagccactcatgtacaagcagatccacaagcaggta
cccgtgctgaagaagtatgcagacaagctcatcgccgagggcaccgtcactctgcaggag
tttgaggaggaaattgccaaatatgaccgtatctgtgaggaggcctacggcaggtccaag
gataagaagatcctgcatataaagcactggctggactccccctggcctggcttcttcaat
gtggatggggagcccaagagcatgacatgccctacgacaggcatccctgaggagatgctg
acccacattggcagtgtggccagctctgtgcccctggaggactttaagatccacacaggc
ctctctcgcatcctgcgtggccgtgcagacatgacaaagaagcgcacagtggactgggcc
ctggcagagtacatggcctttggttcattgctgaaggagggcatccacgtgcgactcagc
ggccaggatgtggagaggggcacattcagccaccggcaccatgttcttcatgaccaggaa
gttgaccggaggacgtgtgtcccgatgaatcatctgtggcctgaccaggccccgtacact
gtgtgcaatagctccctctcagagtatggagttctaggctttgagctgggctatgccatg
gccagccccaacgccctggtcctctgggaagctcagtttggtgatttccacaacacagcc
cagtgtatcatcgaccagttcatcagcactggccaggccaagtgggtgcggcacaatggc
atcgtgcttctgctgccccacggcatggagggcatgggtccagagcactcctcagcaagg
ccagagaggttcctgcagatgagcaatgacgactcggatgcctacccagtgttcactgag
gactttgaggtgagccagctctacgactgcaactggattgtggtgaactgctccacccca
gccagctacttccacgtgctgcgccgacagatcctgctgcccttccgcaagcctctcatt
gtcttcacacccaagtctctgctgaggcaccctgatgccaagtccagctttgaccagatg
gtgtccggaactagcttccagcggctgattccggaagacggccccgcagcacattctcct
gagcaggtccagcggctcatcttctgcacgggaaaggtgtactatgacctggtaaaggaa
cgcagcagccagggcctggagcaacaagtggccatcacacgcctggagcagatctctccg
tttcctttcgacctgatcatgcgggaggcagagaagtactcgggagctgagctggtgtgg
tgtcaggaggaacataagaacatgggctattacgactacatcagtccacgcttcatgact
ctcctcggccactcccggcccatatggtatgtcggccgggacccagcagccgcaccagcc
actgggaataagaacgctcacttggtgtcactgaggaggtttctggatactgccttcaat
ctgaaggccttcgagggcaagacattttag

DBGET integrated database retrieval system