KEGG   Mus musculus (mouse): 239122Help
Entry
239122            CDS       T01002                                 

Gene name
Setdb2, Clld8, Gm293, KMT1F
Definition
(RefSeq) SET domain, bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
mmu  Mus musculus (mouse)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    239122 (Setdb2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     239122 (Setdb2)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     239122 (Setdb2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    239122 (Setdb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
14; 14 C3
AA seq 697 aa AA seqDB search
MEEKNGDAKTFWMELQDDGKVDLMFEKTQNVLHSLKQKIKDGSATNGDYVQAMNLVNEAT
LSNTQTLEKDHTPVTQSEQENKSSAVPSASCDNSCPKGCTIPSPGKKVFLPVKNKADNLV
KKEAPLHISFHRHICSRTCLMETPLSLKGENPLQLPIRCHFQRRHAKTNSHSSALHVNYK
TPCGRNLRNMEEVFHYLLETECNFLFTDNFSFNTYVQLTRNHPKQNEVVSDVDISNGVES
VSIPFCNEIDNSKLPRFKYRNTVWPRIYHLNFSNMFSDSCDCSEGCIDIKKCACLQLTAK
NAKACPLSSDGECAGYKYKRLQRLIPTGIYECNLLCKCNKQMCQNRVIQHGVRVRLQVFK
SEKKGWGVRCLDDIDKGTFVCIYSGRLLRRATPEKTNIGENGREQQHIVKNSFSKKRKLE
VVCSDCDAHCDSPKAEDCPPKLSGDLKEPAVEMNHRNISRTQHHSVIRRTKSKTTVFHYS
EKNMGFVCSDSAAPEDKNGFKPAQEHVNSEARRAHEDLSSNPAGDSEDTQLTESDVIDIT
ASREDSAPAYRCKHATIVDRKDTKQVLEVPGKKSQEEEPAASQSQQALCDEELPSERTKI
PSASLMQLSKESLFLLDASKEGNVGRFLNHSCCPNLWVQNVFVETHDRNFPLVAFFTNRY
VKARTELTWDYGYEAGATPAKEILCQCGFNKCRKKLI
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaaaatggtgatgcaaagactttctggatggagctacaagatgatggtaaa
gttgacttaatgtttgagaaaacacaaaatgtcctacattcactgaaacagaagataaag
gatgggtctgccacaaatggagactatgtccaagcaatgaatctagtaaatgaagccact
ctgagtaacacgcaaacactggaaaaggatcatacacctgtgactcagagtgaacaggaa
aacaaatcaagtgcggttccctctgcatcatgtgacaactcctgtcctaagggctgtact
atcccatctccaggaaaaaaagtattcctccctgtgaagaataaagctgacaatttagtg
aaaaaggaagccccactgcatatatctttccatcgccatatctgctccaggacttgtcta
atggaaaccccactgtccttgaagggagaaaaccccctgcagctaccaatcagatgtcac
ttccaaagacgacatgcaaagacaaactctcattcttctgccctccatgtgaattataaa
acgccctgtggacggaatctacgaaacatggaggaagttttccattacctgcttgaaaca
gagtgtaactttttattcacagacaacttctctttcaatacttatgtccagttgactcgg
aatcacccaaagcaaaatgaagttgtttctgacgtggatattagtaatggagtggaatca
gtgtcgattcctttctgtaatgaaattgacaacagtaaacttccacggtttaagtataga
aatacagtatggccccgaatatatcatctgaacttttccaacatgttttctgattcatgt
gactgttctgagggctgcatagacataaaaaaatgtgcatgtcttcagttgacagcaaag
aatgccaaggcatgtcccttgtcatcggatggagaatgtgctggatataaatacaaaaga
ctgcagaggctcatacctactggcatttatgaatgcaacctgctctgcaagtgtaacaaa
cagatgtgtcaaaaccgagttatccagcatggtgtccgggtgaggctacaggtgttcaaa
agtgagaagaagggctggggagtacgctgcctggatgacattgacaaagggacatttgtg
tgcatttattcaggaaggttactgcgcagagccactcctgagaaaactaatataggtgaa
aatggaagagagcaacagcacattgtgaaaaattcattttccaaaaagaggaaactagaa
gttgtgtgttcagattgtgacgcacactgtgacagtcctaaggctgaggactgccctccc
aagcttagtggtgatctcaaagagcccgctgtggaaatgaaccatagaaatatttcaaga
actcagcatcattcagtcattagaagaactaaatccaagacaactgtttttcattacagt
gagaaaaacatgggatttgtttgctcagattctgccgccccagaagataagaatggattt
aaaccagctcaagaacacgtgaactctgaagctaggagagctcacgaggacttaagttca
aacccagctggagattctgaagacacacagctgactgaatcagacgtgatagatataact
gcaagtagagaagactctgccccagcatacaggtgtaagcacgcaaccatagtggatcgt
aaggacactaaacaggtgcttgaagtcccaggaaagaagtcccaagaggaagagcctgca
gcctctcaaagccagcaggccttgtgtgatgaggagctgccaagtgagaggacaaagatt
ccatctgcttccctgatgcagctcagtaaggagagtctgtttctattggatgcttcaaaa
gaaggaaatgtgggccgtttcctcaatcatagttgctgtccaaatctctgggtgcagaat
gtttttgtagaaacacatgacaggaatttcccattggtggccttcttcaccaacaggtat
gtgaaagcaaggacagaactaacgtgggattatggttatgaagctggggccacgcctgca
aaggaaatcctctgccaatgtgggtttaataagtgtcggaaaaaattaatataa

DBGET integrated database retrieval system