KEGG   Mus musculus (mouse): 67956Help
Entry
67956             CDS       T01002                                 

Gene name
Kmt5a, 2410195B05Rik, AA617402, AW536475, PR-SET7, PR/SET07, Setd8
Definition
(RefSeq) lysine methyltransferase 5A
  KO
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
mmu  Mus musculus (mouse)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    67956 (Kmt5a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     67956 (Kmt5a)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     67956 (Kmt5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
LinkDB All DBs
Position
5; 5 F
AA seq 350 aa AA seqDB search
MARGRKMCKPRAVEAAAAAVAATAPGPEMVEQRGPGRPRSDGENVFAGQSKIYAYMSPNK
CSAMRSPLQEENSVAHHEVKCPGKPLAGIYRKREEKRNTGNVIRSAVKSDEQKSKDTRRG
PLAPFPNQKSEAAEPPKTPPPSCDSTNVAVAKQALKKSLKGKQAPRKKSQGKTQQNRKLT
DFYPVRRSSRKSKAELQSEERKKIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFV
VEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATQETNRLGRLINHSKC
GNCQTKLHDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAYPWLKH
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggctagaggcaggaagatgtgcaagccccgcgcggtggaggcggcggcggcggcggtg
gcggcgacggccccgggcccggagatggtggagcagaggggcccggggaggccccgcagc
gacggggagaacgtgtttgctgggcagtcaaagatctatgcctacatgagtccgaacaag
tgctctgcaatgcgctctccacttcaggaagagaactcggttgcccatcatgaggtcaaa
tgcccggggaaaccattagctggaatctacaggaagcgagaagagaaaaggaacaccggg
aacgttatacgaagcgctgtgaagtcagatgaacagaagagcaaagacaccaggagaggt
cccctggcgccttttccaaaccaaaaatccgaagcagcagaacctccaaaaactccaccc
ccatcatgtgattctaccaatgtagcagtcgctaagcaagccctgaaaaagtccctcaag
ggcaaacaggcccctcggaaaaagtctcaagggaaaacccagcagaatagaaaactcaca
gatttctaccctgtgcggaggagttcccggaagagcaaagctgagctgcagtctgaagaa
aggaagaaaatagatgagctgattgagagcgggaaggaagaaggcatgaagattgatcta
attgatggcaaaggcaggggtgtgatcgctaccaagcagttctccaggggagactttgtg
gtagaataccatggggacctcattgaaatcactgatgccaagaagcgggaggctctgtac
gcacaggacccctccactggctgctacatgtactattttcagtatctgagcaaaacctac
tgcgtggatgccactcaagaaacgaaccgcctagggagactcatcaatcacagtaagtgt
gggaactgccagaccaaactgcacgacatcgacggcgtgcctcacctcatcctcatcgcc
tcccgagacatcgcagctggggaggagctcctgtacgactatggggaccgaagcaaggcc
tccatcgaagcctacccctggctgaagcactaa

DBGET integrated database retrieval system