Microcebus murinus (gray mouse lemur): 105879276 Help Entry 105879276         CDS       T07238                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism mmur  Microcebus murinus (gray mouse lemur) Pathway mmur04015   Rap1 signaling pathway mmur04810   Regulation of actin cytoskeleton mmur05014   Amyotrophic lateral sclerosis mmur05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mmur00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105879276 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105879276 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105879276 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105879276 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mmur04131]     105879276 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mmur04812]     105879276 (PFN1)    04147 Exosome [BR:mmur04147]     105879276 (PFN1) Membrane trafficking [BR:mmur04131]  Others   Actin-binding proteins    Others     105879276 (PFN1) Cytoskeleton proteins [BR:mmur04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105879276 (PFN1) Exosome [BR:mmur04147]  Exosomal proteins   Proteins found in most exosomes    105879276 (PFN1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105879276 NCBI-ProteinID:  XP_012634879 Ensembl:  ENSMICG00000030835 UniProt:  A0A8B7HD97 LinkDB All DBs Position 16:52475553..52478930 Genome browser AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGNCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGLINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggaactgtcaggacgcg gccatcgtgggctacaaggactcgccctccgtctgggccgccgtccccgggaaaaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagttttttt gtgaatgggctgacacttgggggccagaaatgttctgtgatccgggactcactgctgcag gatggggaatttactatggatcttcgtaccaagagcaccggtggagctcccaccttcaac atcactgtcaccatgactgccaagacgctagtcctgttgatgggcaaagaaggtgtccac ggcggtttgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system