KEGG   Methanococcus maripaludis C6: MmarC6_1383Help
Entry
MmarC6_1383       CDS       T00615                                 

Definition
(GenBank) Alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
mmx  Methanococcus maripaludis C6
Pathway
mmx00500  Starch and sucrose metabolism
mmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmx00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MmarC6_1383
Enzymes [BR:mmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MmarC6_1383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: ABX02196
UniProt: A9AA23
LinkDB All DBs
Position
1287445..1288668
Genome map
AA seq 407 aa AA seqDB search
MLLSLNFEVHQPNRLRKSVNLNSGNLWNRYVDVELNKEIFNKVADKCYIPSNMIMLELID
NYDIEISYSITGVFLEQALEFNEEVVELFKDLAKTGNVEFLGETYHHSLSSLFEEHEEFK
EDILEHKKLIKDLFGYKTTTFRNTELIFNNKIAETIKEMGFNGMFTEGANRILDWRSPNY
VYGSLCGLNVLLRNYNLSDDIGFRFSSRDWKEYPLLADKYANWLSNTPGDCINLYMDYET
FGEHQWYDTGIFEFLRHLPKELDNHNHIEYATPSEILELCKPKDTIDVFEFSTLSWADSE
RDISAWLGSRMQQLSFEKLKEIRRYLNQYLLQFDEKERKELIEYKIYKNMQTSDNFYYMC
TKGFNDMDVHSYFSHFSTPYDAYAAYLDTYYDFKNHLVLKLLSTYFK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgttgctgtctcttaatttcgaggtccatcaaccaaacaggcttagaaaatctgtaaat
ttaaacagtgggaatctttggaaccgctatgttgatgtagaattaaacaaagaaattttt
aacaaagtagcggataaatgttatattccctcaaatatgataatgctcgaattaatcgat
aattatgatatcgagatatcttacagtattacgggtgtttttttagagcaggctcttgaa
tttaatgaagaagtcgttgaattatttaaagatttagcaaaaactggaaatgtggaattt
ttaggtgaaacttaccaccattctttatcgagtctttttgaagaacacgaagaatttaaa
gaagatattttggagcataaaaaactgataaaagatctttttggatacaaaacaacgact
tttagaaataccgagctgattttcaacaacaagattgcagaaacaattaaagaaatggga
tttaatggaatgtttacagagggtgccaaccgtattttggattggaggtcgccaaattac
gtttatggctcgttatgcggattaaatgtacttcttagaaattacaatctaagtgatgat
ataggatttagattttcttcaagagactggaaagaatacccattactggctgataaatat
gcaaactggctttcaaatacccctggggattgtataaacttatacatggactatgaaacg
tttggagagcaccaatggtatgatactggaatttttgagtttttaaggcaccttccaaaa
gaactggataaccataaccacattgaatatgcaacaccttccgaaattcttgaactctgt
aaaccaaaagatactatcgatgtttttgaattttcaaccctttcgtgggcagattcagaa
agggacatcagtgcatggcttggaagcagaatgcagcagttatccttcgaaaaattaaaa
gaaataagaagatacttaaaccagtatttattgcaatttgatgaaaaagagcgaaaagag
ttaatagaatataaaatctataagaacatgcagactagtgataatttttactatatgtgc
acgaaaggtttcaatgacatggatgtacactcttatttcagccacttttcaacgccttat
gatgcctatgcagcatatctggacacatattacgattttaagaatcatctagttttaaaa
ttactttcaacatattttaaatga

DBGET integrated database retrieval system