Macaca nemestrina (pig-tailed macaque): 105474081 Help Entry 105474081         CDS       T08765                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism mni  Macaca nemestrina (pig-tailed macaque) Pathway mni01522   Endocrine resistance mni04110   Cell cycle mni04115   p53 signaling pathway mni04151   PI3K-Akt signaling pathway mni04218   Cellular senescence mni04530   Tight junction mni04660   T cell receptor signaling pathway mni04933   AGE-RAGE signaling pathway in diabetic complications mni04934   Cushing syndrome mni05160   Hepatitis C mni05162   Measles mni05163   Human cytomegalovirus infection mni05164   Influenza A mni05165   Human papillomavirus infection mni05166   Human T-cell leukemia virus 1 infection mni05167   Kaposi sarcoma-associated herpesvirus infection mni05169   Epstein-Barr virus infection mni05200   Pathways in cancer mni05203   Viral carcinogenesis mni05212   Pancreatic cancer mni05214   Glioma mni05218   Melanoma mni05219   Bladder cancer mni05220   Chronic myeloid leukemia mni05222   Small cell lung cancer mni05223   Non-small cell lung cancer mni05224   Breast cancer mni05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:mni00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     105474081 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     105474081 (CDK4)    04115 p53 signaling pathway     105474081 (CDK4)    04218 Cellular senescence     105474081 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     105474081 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     105474081 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105474081 (CDK4)    05203 Viral carcinogenesis     105474081 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     105474081 (CDK4)    05225 Hepatocellular carcinoma     105474081 (CDK4)    05214 Glioma     105474081 (CDK4)    05220 Chronic myeloid leukemia     105474081 (CDK4)    05218 Melanoma     105474081 (CDK4)    05219 Bladder cancer     105474081 (CDK4)    05224 Breast cancer     105474081 (CDK4)    05222 Small cell lung cancer     105474081 (CDK4)    05223 Non-small cell lung cancer     105474081 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105474081 (CDK4)    05160 Hepatitis C     105474081 (CDK4)    05164 Influenza A     105474081 (CDK4)    05162 Measles     105474081 (CDK4)    05163 Human cytomegalovirus infection     105474081 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     105474081 (CDK4)    05169 Epstein-Barr virus infection     105474081 (CDK4)    05165 Human papillomavirus infection     105474081 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     105474081 (CDK4)    04934 Cushing syndrome     105474081 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     105474081 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:mni01001]     105474081 (CDK4) Enzymes [BR:mni01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      105474081 (CDK4) Protein kinases [BR:mni01001]  Serine/threonine kinases: CMGC group   CDK family    105474081 (CDK4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  105474081 NCBI-ProteinID:  XP_011726700 LinkDB All DBs Position Unknown AA seq 288 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLVLEMAVGIGRDWGKK NT seq 867 nt NT seq  +upstreamnt  +downstreamnt atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc aatggaggaggagctggaggaggccttcccatcagcacagttcgggaggtggccttactg aggcgactggaggcttttgaacatcccaatgtagtccggctgatggacgtctgtgccaca tcccgaactgaccgggagatcaaggtaaccctggtgtttgagcatgtagaccaagaccta aggacgtatctggacaaagcacccccaccaggcttgccagccgagaccatcaaggatttg atgcgccagtttctaagaggcctagatttccttcatgcaaattgcatcgttcaccgagat ctgaagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggc ctggccagaatctacagctaccagatggcacttacacccgtggttgttacactctggtac cgagctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgtt ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct gaccagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcga gatgtatccctgccccgtggagcctttccccccagagggccccgcccagtgcagtcggtg gtacctgagatggaggagtcgggagcacagctgctgctggtactggagatggctgtgggc atagggagagactggggaaagaaatag

DBGET integrated database retrieval system