KEGG   Methylobacterium nodulans: Mnod_1892Help
Entry
Mnod_1892         CDS       T00839                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
mno  Methylobacterium nodulans
Brite
Translation factors [BR:mno03012]
 Eukaryotic Type
  Elongation factors
   Mnod_1892
 Prokaryotic Type
   Mnod_1892
Mitochondrial biogenesis [BR:mno03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Mnod_1892
Exosome [BR:mno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Mnod_1892
  Exosomal proteins of breast cancer cells
   Mnod_1892
  Exosomal proteins of colorectal cancer cells
   Mnod_1892
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1993175..1994365
Genome map
AA seq 396 aa AA seqDB search
MAKEKFSRTKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETQNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFMNKVDMVDDPELLDLVELEVRELLSKYDFPGDDIPIVKGSALCALE
NREPKIGHDAILELMSHVDSYIPQPERPIDLPFLMPIEDVFSISGRGTVVTGRVERGVIK
VGEEVEIVGIRPTTKTTVTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVVCKPGS
VKPHTKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVQLPEGTEMVMPGDNVT
MDVTLIVPVAMEEKLRFAIREGGRTVGAGVVASIAD
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaagttttcgcggacgaagccgcactgcaacatcgggacgatcgggcac
gttgaccacggcaagacgtctctgacggcggcgatcacgaaggtgctggcggagacgggc
ggcgccaccttcacggcctacgaccagatcgacaaggcgccggaggagaaggcgcgcggg
atcacgatctcgacggcgcacgtggagtacgagacgcagaaccggcactacgcgcacgtg
gactgccccgggcacgccgactacgtgaagaacatgatcacgggcgcggcgcagatggac
ggggcgatcctggtggtgtcggccgcggacgggccgatgccgcagacgcgcgagcacatc
ctgctggcccgccaggtgggcgtgccggcgctggtggtgttcatgaacaaggtcgacatg
gtggacgatccggagcttttggatctggtcgagcttgaggtgcgcgagcttttgtcgaag
tacgacttcccgggcgacgacatcccgatcgtgaagggctcggcgttgtgcgcgctggag
aaccgggagccgaagatcgggcacgacgcgatcctggagctgatgagccacgtcgacagc
tacatcccgcagccggagcggccgatcgacctgccgttcctgatgccgatcgaggacgtg
ttctcgatctcgggccgcggcacggtggtgacgggccgggtggagcgcggggtgatcaag
gtgggcgaggaggtcgagatcgtcggcatccgtccgaccaccaagacgacggtgaccggc
gtcgagatgttccgcaagctgctggaccagggccaggccggcgacaacgtgggcgtgctg
ttgcgcggcaccaagcgcgaggacgtggagcgcgggcaggtggtgtgcaagccgggatcg
gtgaagccgcacaccaagttcaaggcggaggcctacatcctgaccaaggaggagggcggc
cggcacacgccgttcttcaccaactaccggccgcagttctacttccgcaccacggacgtg
accggggtggtgcagctgccggaaggcaccgagatggtgatgccgggcgacaacgtgacc
atggacgtgacgctgatcgtgccggtggcgatggaggagaagctgcgcttcgccatccgc
gagggcggccgcaccgtcggcgccggcgtcgtcgcttccatcgccgattaa

DBGET integrated database retrieval system