Mustela nigripes (black-footed ferret): 132012344 Help Entry 132012344         CDS       T09425                                  Symbol SOD1 Name (RefSeq) superoxide dismutase [Cu-Zn]   KO K04565   superoxide dismutase, Cu-Zn family [EC:1.15.1.1] Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp04146   Peroxisome mnp04213   Longevity regulating pathway - multiple species mnp05012   Parkinson disease mnp05014   Amyotrophic lateral sclerosis mnp05016   Huntington disease mnp05020   Prion disease mnp05022   Pathways of neurodegeneration - multiple diseases mnp05208   Chemical carcinogenesis - reactive oxygen species Brite KEGG Orthology (KO) [BR:mnp00001]  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     132012344 (SOD1)  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     132012344 (SOD1)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     132012344 (SOD1)   09164 Neurodegenerative disease    05012 Parkinson disease     132012344 (SOD1)    05014 Amyotrophic lateral sclerosis     132012344 (SOD1)    05016 Huntington disease     132012344 (SOD1)    05020 Prion disease     132012344 (SOD1)    05022 Pathways of neurodegeneration - multiple diseases     132012344 (SOD1) Enzymes [BR:mnp01000]  1. Oxidoreductases   1.15  Acting on superoxide as acceptor    1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)     1.15.1.1  superoxide dismutase      132012344 (SOD1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sod_Cu Motif Other DBs NCBI-GeneID:  132012344 NCBI-ProteinID:  XP_059248236 LinkDB All DBs Position 2:206624753..206633395 Genome browser AA seq 153 aa AA seqDB search MEMKAVCVLKGQGPVEGTIHFVQKGKGPVEVSGTITGLTEGEHGFHVHQFGDNTQGCTSA GPHFNPLSKNHGGPKDQERHVGDLGNVTAGKDGVAIVSMEDSLISLSGDYSIIGRTMVVH EKQDDLGRGGNEESTKTGNAGSRLACGVIGIAK NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggagatgaaggccgtgtgcgtgttgaagggccagggcccggtggagggcaccatccac ttcgtgcagaagggaaaggggcccgttgaggtgtcaggaaccattacaggattgactgaa ggcgagcatggattccacgtccatcagtttggagataatacacaaggctgtaccagcgca ggtcctcactttaatcctctatccaaaaatcacggtgggccgaaagaccaagagaggcat gttggagacctgggcaatgtgactgctggcaaggatggcgtggccattgtgtccatggaa gattctctgatctcactctcaggagactattccatcattggccgcacaatggtggtccat gagaaacaagatgacttgggcagaggtggcaatgaagagagtacaaagacgggaaacgcc gggagtcgtttggcttgtggtgtcattgggatcgccaagtaa

DBGET integrated database retrieval system