Mustela nigripes (black-footed ferret): 132018657 Help Entry 132018657         CDS       T09425                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism mnp  Mustela nigripes (black-footed ferret) Pathway mnp01523   Antifolate resistance mnp04010   MAPK signaling pathway mnp04014   Ras signaling pathway mnp04024   cAMP signaling pathway mnp04062   Chemokine signaling pathway mnp04064   NF-kappa B signaling pathway mnp04066   HIF-1 signaling pathway mnp04071   Sphingolipid signaling pathway mnp04137   Mitophagy - animal mnp04151   PI3K-Akt signaling pathway mnp04210   Apoptosis mnp04211   Longevity regulating pathway mnp04218   Cellular senescence mnp04380   Osteoclast differentiation mnp04613   Neutrophil extracellular trap formation mnp04620   Toll-like receptor signaling pathway mnp04621   NOD-like receptor signaling pathway mnp04622   RIG-I-like receptor signaling pathway mnp04623   Cytosolic DNA-sensing pathway mnp04625   C-type lectin receptor signaling pathway mnp04657   IL-17 signaling pathway mnp04658   Th1 and Th2 cell differentiation mnp04659   Th17 cell differentiation mnp04660   T cell receptor signaling pathway mnp04662   B cell receptor signaling pathway mnp04668   TNF signaling pathway mnp04722   Neurotrophin signaling pathway mnp04917   Prolactin signaling pathway mnp04920   Adipocytokine signaling pathway mnp04926   Relaxin signaling pathway mnp04931   Insulin resistance mnp04932   Non-alcoholic fatty liver disease mnp04933   AGE-RAGE signaling pathway in diabetic complications mnp04936   Alcoholic liver disease mnp05010   Alzheimer disease mnp05022   Pathways of neurodegeneration - multiple diseases mnp05030   Cocaine addiction mnp05132   Salmonella infection mnp05133   Pertussis mnp05134   Legionellosis mnp05135   Yersinia infection mnp05140   Leishmaniasis mnp05142   Chagas disease mnp05145   Toxoplasmosis mnp05146   Amoebiasis mnp05152   Tuberculosis mnp05160   Hepatitis C mnp05161   Hepatitis B mnp05162   Measles mnp05163   Human cytomegalovirus infection mnp05164   Influenza A mnp05165   Human papillomavirus infection mnp05166   Human T-cell leukemia virus 1 infection mnp05167   Kaposi sarcoma-associated herpesvirus infection mnp05168   Herpes simplex virus 1 infection mnp05169   Epstein-Barr virus infection mnp05170   Human immunodeficiency virus 1 infection mnp05171   Coronavirus disease - COVID-19 mnp05200   Pathways in cancer mnp05202   Transcriptional misregulation in cancer mnp05203   Viral carcinogenesis mnp05207   Chemical carcinogenesis - receptor activation mnp05208   Chemical carcinogenesis - reactive oxygen species mnp05212   Pancreatic cancer mnp05215   Prostate cancer mnp05220   Chronic myeloid leukemia mnp05221   Acute myeloid leukemia mnp05222   Small cell lung cancer mnp05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mnp05321   Inflammatory bowel disease mnp05415   Diabetic cardiomyopathy mnp05417   Lipid and atherosclerosis mnp05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mnp00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132018657 (RELA)    04014 Ras signaling pathway     132018657 (RELA)    04064 NF-kappa B signaling pathway     132018657 (RELA)    04668 TNF signaling pathway     132018657 (RELA)    04066 HIF-1 signaling pathway     132018657 (RELA)    04071 Sphingolipid signaling pathway     132018657 (RELA)    04024 cAMP signaling pathway     132018657 (RELA)    04151 PI3K-Akt signaling pathway     132018657 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     132018657 (RELA)   09143 Cell growth and death    04210 Apoptosis     132018657 (RELA)    04218 Cellular senescence     132018657 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     132018657 (RELA)    04620 Toll-like receptor signaling pathway     132018657 (RELA)    04621 NOD-like receptor signaling pathway     132018657 (RELA)    04622 RIG-I-like receptor signaling pathway     132018657 (RELA)    04623 Cytosolic DNA-sensing pathway     132018657 (RELA)    04625 C-type lectin receptor signaling pathway     132018657 (RELA)    04660 T cell receptor signaling pathway     132018657 (RELA)    04658 Th1 and Th2 cell differentiation     132018657 (RELA)    04659 Th17 cell differentiation     132018657 (RELA)    04657 IL-17 signaling pathway     132018657 (RELA)    04662 B cell receptor signaling pathway     132018657 (RELA)    04062 Chemokine signaling pathway     132018657 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     132018657 (RELA)    04917 Prolactin signaling pathway     132018657 (RELA)    04926 Relaxin signaling pathway     132018657 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     132018657 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     132018657 (RELA)   09149 Aging    04211 Longevity regulating pathway     132018657 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     132018657 (RELA)    05202 Transcriptional misregulation in cancer     132018657 (RELA)    05207 Chemical carcinogenesis - receptor activation     132018657 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     132018657 (RELA)    05203 Viral carcinogenesis     132018657 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     132018657 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     132018657 (RELA)    05221 Acute myeloid leukemia     132018657 (RELA)    05220 Chronic myeloid leukemia     132018657 (RELA)    05215 Prostate cancer     132018657 (RELA)    05222 Small cell lung cancer     132018657 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     132018657 (RELA)    05170 Human immunodeficiency virus 1 infection     132018657 (RELA)    05161 Hepatitis B     132018657 (RELA)    05160 Hepatitis C     132018657 (RELA)    05171 Coronavirus disease - COVID-19     132018657 (RELA)    05164 Influenza A     132018657 (RELA)    05162 Measles     132018657 (RELA)    05168 Herpes simplex virus 1 infection     132018657 (RELA)    05163 Human cytomegalovirus infection     132018657 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     132018657 (RELA)    05169 Epstein-Barr virus infection     132018657 (RELA)    05165 Human papillomavirus infection     132018657 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     132018657 (RELA)    05135 Yersinia infection     132018657 (RELA)    05133 Pertussis     132018657 (RELA)    05134 Legionellosis     132018657 (RELA)    05152 Tuberculosis     132018657 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     132018657 (RELA)    05145 Toxoplasmosis     132018657 (RELA)    05140 Leishmaniasis     132018657 (RELA)    05142 Chagas disease     132018657 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     132018657 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     132018657 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     132018657 (RELA)   09165 Substance dependence    05030 Cocaine addiction     132018657 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     132018657 (RELA)    05418 Fluid shear stress and atherosclerosis     132018657 (RELA)    05415 Diabetic cardiomyopathy     132018657 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     132018657 (RELA)    04932 Non-alcoholic fatty liver disease     132018657 (RELA)    04931 Insulin resistance     132018657 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     132018657 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     132018657 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mnp03000]     132018657 (RELA) Transcription factors [BR:mnp03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     132018657 (RELA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  132018657 NCBI-ProteinID:  XP_059257551 LinkDB All DBs Position 1:6449194..6457897 Genome browser AA seq 542 aa AA seqDB search MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTDPRPLPRRIAVPSRSTTSIPKPAPQPYPFTPSLSTINF EEFSPMVFPSGQIPNQTPALAPAPAPILAPVPAPAPAPAPILAPPGLAQPVAPPAPKTAQ AGEGTLSEALLQLQFDADEDLGALLGSSADPAVFTDLACVDNSEFQQLLNQGVSAAPHTA EPMLMEYPEAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSIADMDFSALLSQI SS NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt atggacgacctgtttcccctcatcttcccgtctgagcctgcgcaggcctctggcccctat gtggagatcatcgagcagcccaagcagcggggaatgcgcttccgctacaagtgcgagggc cgctcagcgggcagtatcccaggcgagaggagcacggataccaccaagacccatcccacc atcaagatcaatggctacacggggccggggacagttcgcatctctctggtcaccaaagac ccccctcaccggcctcacccccatgagcttgtggggaaagactgccgggatggcttctat gaggctgagctctgcccagaccgctgcatccacagcttccagaacctggggatccagtgt gtaaagaagcgggacctggagcaggccatcagtcaacgcatccagaccaataacaatccc ttccaagttcccatagaagaacagcgtggggactatgacctgaacgcagtgcggctctgc ttccaggtgacagtgcgggacccggcaggcaggcccctccgcttgtcacccgtcctctct catcccatttttgacaaccgcgcccccaacactgctgagctcaagatctgccgggtgaac cggaactccgggagctgcctcggcggggatgagatcttcctgctgtgtgacaaggtgcag aaagaggacattgaagtgtatttcacgggaccaggctgggaggcccgaggctccttttca caagctgacgtccaccgacaagtggccattgtgttccggacacctccctacgcggacccc agcctgcaggcccccgtgcgtgtctccatgcagctgcggcggccttcagatcgggagctc agtgagcccatggagttccagtacttgccagacacagatgatcgtcaccggattgaggag aagcgcaaaaggacatacgagaccttcaagagcatcatgaagaaaagtcccttcaatgga cccactgaccccaggcctctgccccggcgcattgcggtgccttcccgaagcacaacttcc atccccaagccagctccccagccctatccctttacgccatccctcagcaccatcaacttc gaggagttctcccccatggtctttccttcggggcagattccaaaccagacccctgccttg gcaccggcccctgcccccatcctggccccggtcccagccccggccccagccccggcccca atcttagcccccccgggcctcgctcagcctgtggccccccccgcccccaagaccgcccag gccggggaagggacactgtcggaggccctgctgcagctgcagtttgacgctgacgaagac ctgggggccctgctgggcagcagcgctgaccccgccgtgttcacagacctggcatgtgtc gacaactcggagtttcagcagctgctgaaccaaggtgtatctgcggccccacacacagcc gagcccatgctgatggagtaccctgaggcaataactcgcctggtgacagggtcccagagg ccccccgacccagctcctgctcccctgggggcctctgggctccccaacggcctcctctca ggggatgaagacttctcctccattgcagacatggacttctcagccctcctgagtcagatc agctcctaa

DBGET integrated database retrieval system