KEGG   Microvirga ossetica: BB934_20825Help
Entry
BB934_20825       CDS       T05139                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
moc  Microvirga ossetica
Brite
Translation factors [BR:moc03012]
 Eukaryotic Type
  Elongation factors
   BB934_20825
 Prokaryotic Type
   BB934_20825
Mitochondrial biogenesis [BR:moc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    BB934_20825
Exosome [BR:moc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BB934_20825
  Exosomal proteins of breast cancer cells
   BB934_20825
  Exosomal proteins of colorectal cancer cells
   BB934_20825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4412588..4413778
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAESGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETKNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSSADGPMPQTREHI
LLARQVGVPALVVFMNKVDMVDDAELLDLVELEVRELLSKYDFPGDDIPIVKGSALCALE
DRSPEIGRERVLELMAEVDRYIPQPERPVDQPFLMPIEDVFSISGRGTVVTGRVERGIVK
VGEEVEIVGLRDTQKTTVTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVLCKPGS
IKPHTKFKAEAYILTKEEGGRHTPFFGNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNIT
MEVTLIAPIAMEEKLRFAIREGGRTVGAGVVAAVID
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaggaaaagtttgagcggaataagccgcactgcaacattgggacgattggccat
gttgaccatggcaagacgtctctgacggcggcgatcacgaaggttctggcggagtcgggc
ggggcgacgtttacggcgtacgaccagatcgacaaggctccggaggagaaggcgcgcggg
atcacgatctcgacggcgcatgtcgagtacgagaccaagaaccggcactatgcccacgtg
gactgccccggtcacgccgactacgtgaagaacatgatcacgggtgcggcgcagatggac
ggcgcgatcctggtggtgtcctccgccgacgggccgatgccgcagacgcgcgagcacatc
cttctggcgcgccaggtcggcgttccggcgctggtggtgttcatgaacaaggtcgacatg
gtcgacgacgccgagctgctcgacctggtcgagctcgaggtgcgcgagcttctgtcgaag
tacgacttcccgggcgacgacatcccgatcgtgaagggctcggccctgtgcgctctggag
gaccgttcgccggagatcggccgtgagcgcgtgctcgagctgatggccgaggtcgaccgc
tacatcccgcagccggagcgtccggttgaccagccgttcctgatgccgatcgaggacgtg
ttctcgatctcgggccgcggcacggtggtgacgggccgcgtcgagcgcggcatcgtgaag
gtcggcgaggaagtggagatcgtgggtcttcgcgacacgcagaagacgacggtgacgggc
gtggagatgttccgcaagctgctcgaccagggccaggcgggcgacaacgtgggcgtgctg
ctgcgcggcacgaagcgcgaggacgtggagcgcggccaggtgctgtgcaagccgggctcg
atcaagccgcacacgaagttcaaggccgaggcgtacatcctgacgaaggaagagggcggt
cgtcatacgccgttcttcggcaactaccgtccgcagttctacttccgcacgacggacgtg
acgggcgtggtgacgctgcccgagggcaccgagatggtgatgccgggcgacaacatcacg
atggaagtgacgctgattgcgccgatcgccatggaggagaagctgcgcttcgccatccgt
gaaggcggccgcaccgtcggcgccggcgtcgtcgccgccgtcatcgactga

DBGET integrated database retrieval system