KEGG   Mesorhizobium opportunistum: Mesop_1030Help
Entry
Mesop_1030        CDS       T01542                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E1 subunit
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mop  Mesorhizobium opportunistum
Pathway
mop00020  Citrate cycle (TCA cycle)
mop00310  Lysine degradation
mop00380  Tryptophan metabolism
mop01100  Metabolic pathways
mop01110  Biosynthesis of secondary metabolites
mop01120  Microbial metabolism in diverse environments
mop01130  Biosynthesis of antibiotics
mop01200  Carbon metabolism
Module
mop_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mop_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mop00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mesop_1030
  Amino acid metabolism
   00310 Lysine degradation
    Mesop_1030
   00380 Tryptophan metabolism
    Mesop_1030
Enzymes [BR:mop01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Mesop_1030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: AEH85516
UniProt: F7YC46
LinkDB All DBs
Position
1076396..1079383
Genome map
AA seq 995 aa AA seqDB search
MARQDQANDQFSLTSFLYGGNADYIDALYAAYEDDPASVNPEWQEFFAGLKDDAGDVRRN
AKGASWAKPSWPLQANGELVSALDGNWGIVEKTIEKKVKDKAVTNGVVLSDADVHQATRD
SVRAIMMIRAYRMRGHLHANLDPLGIAKPLEDYNELSPENYGFTEADYDRPIFLDNVLGL
EFGSIRQMLEILTRTYCSTLGVEFMHISDPEEKAWIQARIEGADKEISFTATGKKAILSK
LVEAEGFEQFIDVKYKGTKRFGLDGSEALIPALEQIVKRGGQLGMKEIVLGMAHRGRLNV
LSQVMAKPHRAIFHEFKGGSAAPDEVEGSGDVKYHLGASSDREFDGNKVHLSLTANPSHL
EIVDPVVMGKARAKQDSLFGRGREEIVPLEERAKVLPLLLHGDAAFAGQGVIAEILGLSG
LRGHRVAGTLHFIINNQIGFTTNPRFSRSSPYPSDVAKMIEAPIFHVNGDDPEAVVHATK
VAIEFRMKFHKPVVVDMFCYRRFGHNEGDEPAFTQPIMYRNIRTHKTTVQIYGERLIAEG
HISQAELDQMKADWRAHLESEWEVGQHYKPNKADWLDGAWSGLRTADNQDEQRRGKTAVP
VKTLKEIGKKLTEVPKGFEAHKTIIRFLENRREAIESGEGIDWSTAEALAFGAILLDGNP
IRLSGQDSERGTFSQRHSVLYDQRDETRYIPLNNLSAAQAGYEVINSMLSEEAVLGFEYG
YSLAEPKALTLWEAQFGDFANGAQVVFDQFISSGERKWLRMSGLVCLLPHGYEGQGPEHS
SARLERFLQLCAEDNMQVANCTTPANYFHILRRQLKRDFRKPLILMTPKSLLRHKRAVST
LPEISGESSFHRLLWDDAQLLPNQPIKLTKDSKIRRVVLCTGKVYYDLYEEREKRGINDI
YLLRVEQLYPFPAKALITELSRFRNAEMVWCQEEPKNMGAWSFIDPYLEWVLAHIDAKHQ
RVRYTGRPASASPATGLMSKHLAQLAALLEDALGE
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atggcaagacaagatcaggccaacgaccagttttctctcacctcattcctctatggcggg
aacgccgattacatcgacgcgctctatgccgcctatgaggacgatcccgcctcggtcaat
cccgagtggcaggagttcttcgccgggctgaaggacgatgccggcgatgtgcgcaggaat
gccaagggcgcttcctgggcaaagccctcctggccgctgcaggccaatggcgaactggtg
tcggcgctcgacggcaattggggcatcgtcgagaagacgatcgaaaagaaggtcaaggac
aaggcggtcaccaacggcgtggtgctgtccgatgccgatgtgcaccaggcgacgcgcgat
tccgtgcgcgccatcatgatgatccgcgcctaccgcatgcgcggccatctgcacgccaat
ctcgacccgctcggcatcgccaagccgctcgaggactacaatgaattgtcgcccgagaat
tacggcttcaccgaagccgactacgaccggccgatcttcctcgacaacgtgctcggcctc
gaattcggctctatccggcagatgctggagatcctgacccgcacctattgctcgacgctc
ggcgtcgagttcatgcacatctccgatcccgaggaaaaggcctggatccaggctcgtatc
gaaggcgccgacaaggaaatctccttcaccgccaccggcaagaaggcgatcctttcgaag
ctggtggaggcggaaggcttcgagcagttcatcgacgtcaagtacaagggcaccaagcgc
ttcggcctcgacggcagtgaagcgttgattccggcgctggaacagatcgtcaagcgcggc
ggccagctcggcatgaaggagatcgtgctcggcatggcccaccgcggccggctgaacgtg
ctcagccaggtgatggccaaaccgcaccgcgccattttccacgagttcaagggcggctcc
gctgcgcctgacgaggtcgagggctccggcgacgtcaagtaccatctcggcgcctcgtcg
gaccgcgagttcgacggcaacaaggtgcatctgtcgctgaccgccaacccctcgcatctg
gagatcgtcgatccggttgtgatgggcaaggcgcgcgccaagcaggactctctgttcggt
cgcggccgcgaggagatcgtgccgctggaggagcgcgccaaggtgctgccgctgctgctg
catggcgacgccgcctttgccggccagggcgtgatcgccgaaatcctcggcctgtcgggc
ctgcgtggccaccgcgtcgccggcacgctgcatttcatcatcaacaaccagatcggcttc
accaccaatccgcgcttctcgcgctcgtcgccctatccgtccgacgtcgccaagatgatc
gaggcgccgatcttccacgtcaatggcgacgatccggaagccgtggtgcatgccaccaag
gtggcgatcgaattccgcatgaagttccacaagccggttgtggtcgacatgttctgctac
cgccgcttcggccacaatgagggcgacgaacccgctttcacccagccgatcatgtaccgc
aacatccgcacccataagacgacggtgcagatctatggcgaacggctgatcgccgagggc
catatcagccaggccgaactcgaccagatgaaggccgactggcgcgcacacctggaatcc
gaatgggaagtcggccagcactacaagcccaacaaggccgactggctcgacggcgcctgg
tcgggcctgcgcacggccgacaaccaggacgaacaaaggcgcggcaagaccgctgtgccg
gtcaagacgctgaaggagatcggcaagaagctgaccgaggtgccgaagggcttcgaggcg
cacaagacgatcatccgcttcctcgaaaaccgccgcgaggcgatcgaatcgggcgaaggc
atcgactggtcgacggccgaggcgctggccttcggcgccatcctgctcgacggcaacccg
atccgcctgtcggggcaggattccgaacgcggcaccttctcgcagcgccattcggtgctc
tacgaccagcgcgacgagacccgctacatcccgctcaacaatctgtcggcggcgcaggct
ggctacgaagtcatcaactcgatgctgtcggaagaagcggtgctcggcttcgaatatggc
tacagcctggccgagcctaaggcgctgacgctgtgggaagcgcagttcggcgacttcgcc
aacggcgcccaggtggtgttcgaccagttcatctcctcgggcgagcgcaagtggctcaga
atgtcgggcctcgtctgcctgttgccgcatggctatgaaggccagggcccggagcactcc
tcggcacggctggagcgcttcctgcagctttgcgccgaggacaacatgcaagtggccaat
tgcacgacgccggccaactacttccacatcctgcgccggcagctgaagcgggatttccgc
aagccgctgatcctgatgacgccgaagtcgctgctgcgccacaagcgggcggtgtcgacg
ctgccggaaatctcgggcgaaagctcgttccaccggctgctgtgggacgacgcccagctc
ttgcccaaccagccgatcaagctcaccaaggattccaagatccgccgcgtcgtgctgtgc
acgggcaaggtctattacgatctctacgaggagcgcgagaagcgcggcatcaacgacatc
tatctgctgcgcgtcgaacagctctatccattcccggccaaggcgctgatcaccgaattg
tcgcgtttccgcaacgccgagatggtgtggtgccaggaggagcccaagaacatgggcgcc
tggtcgttcatcgacccctatctggaatgggtgctggcacatatcgacgccaagcatcag
cgggtgcgctacaccggccggccggcgtccgcgtcgccggcgaccgggctgatgtccaag
caccttgcccagctcgccgccctgctcgaagacgcgcttggtgaatag

DBGET integrated database retrieval system