KEGG   Methylobacterium oryzae: MOC_5529Help
Entry
MOC_5529          CDS       T03299                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
mor  Methylobacterium oryzae
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mor00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MOC_5529
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MOC_5529
Enzymes [BR:mor01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MOC_5529
Peptidoglycan biosynthesis and degradation proteins [BR:mor01011]
 Precursor biosynthesis
  Racemase
   MOC_5529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5552591..5553763)
Genome map
AA seq 390 aa AA seqDB search
MAAAHQGAAPGVAMSRIDRDHRPDAGPAGTAAALLTIDLGAIADNYRALALQAGPAVCAA
VVKADAYGLGADRVAPVLAAAGCRHFFVAQVGEGVALRAILGPGPVIAVLNGASPGSEAA
CAAHDLVPVLNDRSQRDGWQGLARRLDRRLPAILQIDSGMARFGFAPDEACALLDAPDAL
AGLDLQLVMSHLACAGEPDSPVNAAQRAVFEVVRRRLPAVPASLAASSGIFLGPDFRFDL
VRPGAALYGIAPQADAPNPMRPVIGLRARVMQTRSVPAGTPVGYGHAATVGRDSRLATVA
IGYADGFFRSTAGGAAWFGGTRLPVVGRVSMDSLVLDVTDLAPGTIGPGALVDIIGPERD
VDAVAAAAGTIGYEVLTNLGHRFHRVYLGA
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
ttggcggcagcgcatcagggagccgccccgggggtcgccatgagcaggatcgatcgcgat
caccggcccgatgccggtcccgcaggcacggcagccgcgctcctgacgatcgacctcggg
gccatcgccgacaattaccgcgccctcgcgttgcaggccgggccggccgtctgcgcggcg
gtggtcaaggcggacgcctacgggctcggcgccgaccgggtggcgccggtcctggccgcc
gccggctgtcggcacttcttcgtggcgcaggtcggcgagggcgtcgccctccgggcgatc
ctcggccccggccccgtgatcgccgtgctcaacggcgcctccccgggcagcgaggcggcc
tgcgcggcccacgacctcgtccccgtcctcaacgaccggtcgcagcgcgacggctggcag
ggtctcgcccggcgcctggaccggcgcctgcccgcgatcctccagatcgattccggcatg
gcccggttcggcttcgcgccggacgaagcctgcgcgctcctcgacgcgccggacgcgctc
gcgggcctcgacctgcagctggtgatgagccacctcgcctgtgcgggcgagccggacagc
cccgtcaacgcggcgcagcgcgccgtcttcgaggtcgtccggcggcgcctgccggccgtg
cccgcgagcctcgcggcctcctccgggatcttcctcgggccggacttccggttcgacctg
gtgcgccccggcgccgccctctacgggatcgccccgcaggcggacgccccgaatccgatg
cggccggtgatcggtctgcgggcgcgggtgatgcagacgcgcagcgtcccggccggaacc
cccgtcggctacgggcacgcggcgaccgtcggccgggacagccgcctcgccaccgtggcg
atcggctacgcggacgggttcttccgcagcaccgccggtggggcggcctggttcggcggc
acgcgcctgcccgtggtcgggcgggtctcgatggacagcctcgtcctggacgtcaccgac
ctggcccccggcacgatcgggccgggggcgctcgtcgacatcatcgggccggagcgcgac
gtcgacgccgtcgccgcggcggccggcacgatcggctacgaggtcctgaccaacctcggc
caccgcttccaccgcgtctatctcggagcctga

DBGET integrated database retrieval system