KEGG   Candidatus Methylomirabilis oxyfera: DAMO_2166Help
Entry
DAMO_2166         CDS       T02155                                 

Gene name
cbbS
Definition
(GenBank) Ribulose bisphosphate carboxylase small chain (RuBisCO small subunit)
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mox  Candidatus Methylomirabilis oxyfera
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mox00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    DAMO_2166 (cbbS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    DAMO_2166 (cbbS)
Enzymes [BR:mox01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     DAMO_2166 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1872152..1872574
Genome map
AA seq 140 aa AA seqDB search
MRITQGTFSFLADLTDDQIRKQVEYALNNKWAVSVEFTDDPHPRNTFWEMWGLPMFDLED
PAGVMYEIDACRKAYPNHYIKVNAFDHNKGWETIRLSFIIHRPPHEPGFGLVRQEVKGRT
VNYVVHSYATDKPEGARYTD
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcacccaaggtacgttctcgttcctggctgatctgaccgacgaccagatcaga
aagcaggtagagtatgcattgaacaataaatgggccgtcagtgtcgagtttacggatgac
ccgcatccccgcaatacgttctgggaaatgtgggggttgccgatgttcgacctggaagac
ccggcgggggtcatgtatgagatcgatgcttgccgcaaggcctatcccaaccactatatc
aaggtgaacgccttcgaccataacaaaggttgggaaaccatccgtctgtcgttcattatc
catcggccgccgcatgagccgggctttggccttgtgcgccaggaagtcaaaggccgcacc
gtcaactatgtcgtgcacagctatgctaccgacaagccggagggcgcgcggtatacggac
tga

DBGET integrated database retrieval system