Mus pahari (shrew mouse): 110317041 Help Entry 110317041         CDS       T05929                                  Symbol Rela Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism mpah  Mus pahari (shrew mouse) Pathway mpah01523   Antifolate resistance mpah04010   MAPK signaling pathway mpah04014   Ras signaling pathway mpah04024   cAMP signaling pathway mpah04062   Chemokine signaling pathway mpah04064   NF-kappa B signaling pathway mpah04066   HIF-1 signaling pathway mpah04071   Sphingolipid signaling pathway mpah04137   Mitophagy - animal mpah04151   PI3K-Akt signaling pathway mpah04210   Apoptosis mpah04211   Longevity regulating pathway mpah04218   Cellular senescence mpah04380   Osteoclast differentiation mpah04613   Neutrophil extracellular trap formation mpah04620   Toll-like receptor signaling pathway mpah04621   NOD-like receptor signaling pathway mpah04622   RIG-I-like receptor signaling pathway mpah04623   Cytosolic DNA-sensing pathway mpah04625   C-type lectin receptor signaling pathway mpah04657   IL-17 signaling pathway mpah04658   Th1 and Th2 cell differentiation mpah04659   Th17 cell differentiation mpah04660   T cell receptor signaling pathway mpah04662   B cell receptor signaling pathway mpah04668   TNF signaling pathway mpah04722   Neurotrophin signaling pathway mpah04917   Prolactin signaling pathway mpah04920   Adipocytokine signaling pathway mpah04926   Relaxin signaling pathway mpah04931   Insulin resistance mpah04932   Non-alcoholic fatty liver disease mpah04933   AGE-RAGE signaling pathway in diabetic complications mpah04936   Alcoholic liver disease mpah05010   Alzheimer disease mpah05022   Pathways of neurodegeneration - multiple diseases mpah05030   Cocaine addiction mpah05132   Salmonella infection mpah05133   Pertussis mpah05134   Legionellosis mpah05135   Yersinia infection mpah05140   Leishmaniasis mpah05142   Chagas disease mpah05145   Toxoplasmosis mpah05146   Amoebiasis mpah05152   Tuberculosis mpah05160   Hepatitis C mpah05161   Hepatitis B mpah05162   Measles mpah05163   Human cytomegalovirus infection mpah05164   Influenza A mpah05165   Human papillomavirus infection mpah05166   Human T-cell leukemia virus 1 infection mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05168   Herpes simplex virus 1 infection mpah05169   Epstein-Barr virus infection mpah05170   Human immunodeficiency virus 1 infection mpah05171   Coronavirus disease - COVID-19 mpah05200   Pathways in cancer mpah05202   Transcriptional misregulation in cancer mpah05203   Viral carcinogenesis mpah05207   Chemical carcinogenesis - receptor activation mpah05208   Chemical carcinogenesis - reactive oxygen species mpah05212   Pancreatic cancer mpah05215   Prostate cancer mpah05220   Chronic myeloid leukemia mpah05221   Acute myeloid leukemia mpah05222   Small cell lung cancer mpah05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mpah05321   Inflammatory bowel disease mpah05415   Diabetic cardiomyopathy mpah05417   Lipid and atherosclerosis mpah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110317041 (Rela)    04014 Ras signaling pathway     110317041 (Rela)    04064 NF-kappa B signaling pathway     110317041 (Rela)    04668 TNF signaling pathway     110317041 (Rela)    04066 HIF-1 signaling pathway     110317041 (Rela)    04071 Sphingolipid signaling pathway     110317041 (Rela)    04024 cAMP signaling pathway     110317041 (Rela)    04151 PI3K-Akt signaling pathway     110317041 (Rela)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     110317041 (Rela)   09143 Cell growth and death    04210 Apoptosis     110317041 (Rela)    04218 Cellular senescence     110317041 (Rela)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110317041 (Rela)    04620 Toll-like receptor signaling pathway     110317041 (Rela)    04621 NOD-like receptor signaling pathway     110317041 (Rela)    04622 RIG-I-like receptor signaling pathway     110317041 (Rela)    04623 Cytosolic DNA-sensing pathway     110317041 (Rela)    04625 C-type lectin receptor signaling pathway     110317041 (Rela)    04660 T cell receptor signaling pathway     110317041 (Rela)    04658 Th1 and Th2 cell differentiation     110317041 (Rela)    04659 Th17 cell differentiation     110317041 (Rela)    04657 IL-17 signaling pathway     110317041 (Rela)    04662 B cell receptor signaling pathway     110317041 (Rela)    04062 Chemokine signaling pathway     110317041 (Rela)   09152 Endocrine system    04920 Adipocytokine signaling pathway     110317041 (Rela)    04917 Prolactin signaling pathway     110317041 (Rela)    04926 Relaxin signaling pathway     110317041 (Rela)   09156 Nervous system    04722 Neurotrophin signaling pathway     110317041 (Rela)   09158 Development and regeneration    04380 Osteoclast differentiation     110317041 (Rela)   09149 Aging    04211 Longevity regulating pathway     110317041 (Rela)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110317041 (Rela)    05202 Transcriptional misregulation in cancer     110317041 (Rela)    05207 Chemical carcinogenesis - receptor activation     110317041 (Rela)    05208 Chemical carcinogenesis - reactive oxygen species     110317041 (Rela)    05203 Viral carcinogenesis     110317041 (Rela)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     110317041 (Rela)   09162 Cancer: specific types    05212 Pancreatic cancer     110317041 (Rela)    05221 Acute myeloid leukemia     110317041 (Rela)    05220 Chronic myeloid leukemia     110317041 (Rela)    05215 Prostate cancer     110317041 (Rela)    05222 Small cell lung cancer     110317041 (Rela)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110317041 (Rela)    05170 Human immunodeficiency virus 1 infection     110317041 (Rela)    05161 Hepatitis B     110317041 (Rela)    05160 Hepatitis C     110317041 (Rela)    05171 Coronavirus disease - COVID-19     110317041 (Rela)    05164 Influenza A     110317041 (Rela)    05162 Measles     110317041 (Rela)    05168 Herpes simplex virus 1 infection     110317041 (Rela)    05163 Human cytomegalovirus infection     110317041 (Rela)    05167 Kaposi sarcoma-associated herpesvirus infection     110317041 (Rela)    05169 Epstein-Barr virus infection     110317041 (Rela)    05165 Human papillomavirus infection     110317041 (Rela)   09171 Infectious disease: bacterial    05132 Salmonella infection     110317041 (Rela)    05135 Yersinia infection     110317041 (Rela)    05133 Pertussis     110317041 (Rela)    05134 Legionellosis     110317041 (Rela)    05152 Tuberculosis     110317041 (Rela)   09174 Infectious disease: parasitic    05146 Amoebiasis     110317041 (Rela)    05145 Toxoplasmosis     110317041 (Rela)    05140 Leishmaniasis     110317041 (Rela)    05142 Chagas disease     110317041 (Rela)   09163 Immune disease    05321 Inflammatory bowel disease     110317041 (Rela)   09164 Neurodegenerative disease    05010 Alzheimer disease     110317041 (Rela)    05022 Pathways of neurodegeneration - multiple diseases     110317041 (Rela)   09165 Substance dependence    05030 Cocaine addiction     110317041 (Rela)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110317041 (Rela)    05418 Fluid shear stress and atherosclerosis     110317041 (Rela)    05415 Diabetic cardiomyopathy     110317041 (Rela)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     110317041 (Rela)    04932 Non-alcoholic fatty liver disease     110317041 (Rela)    04931 Insulin resistance     110317041 (Rela)    04933 AGE-RAGE signaling pathway in diabetic complications     110317041 (Rela)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     110317041 (Rela)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mpah03000]     110317041 (Rela) Transcription factors [BR:mpah03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     110317041 (Rela) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  110317041 NCBI-ProteinID:  XP_021047054 Ensembl:  MGP_PahariEiJ_G0014059 LinkDB All DBs Position 1:117034158..117044821 Genome browser AA seq 549 aa AA seqDB search MDDLFPLIFPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRCIHSFQNLGIQC VKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLLLTPVLS HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE KRKRTYETFKSIMKKSPFNGPTEPRPPTRRIAVPTRNSTSVPKPAPQPYTFPASLSTINF DEFSPMLLPSGQISSQALALAPSSAPVLAQTMVPSSAMVPLAQPPAPVPVLAPGPPQSLS APVPKSTQAGEGALSEALLHLQFDADEDLGALLGSNTDPGVFTDLASVDNSEFQQLLNQG VSMSHSTAEPMLMEYPEAITRLVTGSQRPPDPAPAPLGTSGLPNGLSGDEDFSSIADMDF SALLSQISS NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt atggacgatctgtttcccctcatctttccctcggagccagcccaggcttctgggccttat gtggagatcatcgagcagcccaagcagcggggcatgagattccgctataagtgcgagggt cgctcagcgggcagtattcctggcgagagaagcacagataccaccaagacacaccccacc atcaagatcaatggctacacaggaccaggaacagttcgaatctccctggtcaccaaggat ccacctcaccggcctcatccacatgaacttgtggggaaggactgccgggacggctactat gaggctgacctctgcccagaccgctgtatccatagcttccagaacctggggatccagtgt gtgaagaagcgagacctggagcaagccattagccagcgaatccagaccaacaataacccc tttcacgttcccatagaggagcagcgcggggactatgacttgaatgcagtgcgcctctgc ttccaggtgacagtgagggacccagcaggcaggcccctcctcctgactcctgtcctctca catccaatttttgataaccgggcccccaacactgccgagctcaagatctgccgagtaaac cggaactctgggagctgcctcggtggggatgagatcttcttgctgtgtgacaaggtgcag aaagaagacattgaggtgtatttcacgggaccaggctgggaggcacgaggctccttttca caagctgatgtgcaccggcaagtggccattgtgttccggactcctccatacgccgacccc agcctacaggctcctgtgcgagtctccatgcagctacgacggccttctgatcgggagctc agtgagcccatggagttccagtacttgccagacacagatgatcgccaccggattgaagag aaacgcaaaaggacctatgagaccttcaagagcatcatgaagaagagtcctttcaatgga ccaactgaaccccggcctccaacccggcgtattgctgtgcctacccgaaactcaacttct gtccccaagccagccccccagccctacaccttcccagcatccctcagcaccatcaacttt gatgagttttcccccatgctgttaccatcggggcagatctcaagccaggccctggccttg gcaccatcctctgccccagtcctggcccagaccatggtcccctcctcagccatggtacct ctggctcagcccccagctcctgtcccagttctagccccgggtcctccccagtccctgtct gcacctgttccaaagagcacgcaggccggggaaggcgcgctgtcggaagccctgctgcac ctgcagtttgacgctgatgaagacttgggggccttgcttggcagcaacacagacccagga gtgttcacagacctggcatctgtggacaactcagagtttcagcagctcctcaaccagggt gtgtccatgtctcactccacagctgagcccatgctgatggagtaccctgaagctataact cgcctggtgacagggtcccagaggccccctgacccagctcctgcacccctggggacctcg gggcttcccaatggtctctccggagatgaagacttctcctccattgcggacatggacttc tctgctcttttgagtcagatcagctcctaa

DBGET integrated database retrieval system