Mus pahari (shrew mouse): 110326196 Help Entry 110326196         CDS       T05929                                  Symbol Cdk4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism mpah  Mus pahari (shrew mouse) Pathway mpah01522   Endocrine resistance mpah04110   Cell cycle mpah04115   p53 signaling pathway mpah04151   PI3K-Akt signaling pathway mpah04218   Cellular senescence mpah04530   Tight junction mpah04660   T cell receptor signaling pathway mpah04933   AGE-RAGE signaling pathway in diabetic complications mpah04934   Cushing syndrome mpah05160   Hepatitis C mpah05162   Measles mpah05163   Human cytomegalovirus infection mpah05164   Influenza A mpah05165   Human papillomavirus infection mpah05166   Human T-cell leukemia virus 1 infection mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05169   Epstein-Barr virus infection mpah05200   Pathways in cancer mpah05203   Viral carcinogenesis mpah05212   Pancreatic cancer mpah05214   Glioma mpah05218   Melanoma mpah05219   Bladder cancer mpah05220   Chronic myeloid leukemia mpah05222   Small cell lung cancer mpah05223   Non-small cell lung cancer mpah05224   Breast cancer mpah05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     110326196 (Cdk4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     110326196 (Cdk4)    04115 p53 signaling pathway     110326196 (Cdk4)    04218 Cellular senescence     110326196 (Cdk4)   09144 Cellular community - eukaryotes    04530 Tight junction     110326196 (Cdk4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     110326196 (Cdk4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110326196 (Cdk4)    05203 Viral carcinogenesis     110326196 (Cdk4)   09162 Cancer: specific types    05212 Pancreatic cancer     110326196 (Cdk4)    05225 Hepatocellular carcinoma     110326196 (Cdk4)    05214 Glioma     110326196 (Cdk4)    05220 Chronic myeloid leukemia     110326196 (Cdk4)    05218 Melanoma     110326196 (Cdk4)    05219 Bladder cancer     110326196 (Cdk4)    05224 Breast cancer     110326196 (Cdk4)    05222 Small cell lung cancer     110326196 (Cdk4)    05223 Non-small cell lung cancer     110326196 (Cdk4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     110326196 (Cdk4)    05160 Hepatitis C     110326196 (Cdk4)    05164 Influenza A     110326196 (Cdk4)    05162 Measles     110326196 (Cdk4)    05163 Human cytomegalovirus infection     110326196 (Cdk4)    05167 Kaposi sarcoma-associated herpesvirus infection     110326196 (Cdk4)    05169 Epstein-Barr virus infection     110326196 (Cdk4)    05165 Human papillomavirus infection     110326196 (Cdk4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     110326196 (Cdk4)    04934 Cushing syndrome     110326196 (Cdk4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     110326196 (Cdk4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:mpah01001]     110326196 (Cdk4) Enzymes [BR:mpah01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      110326196 (Cdk4) Protein kinases [BR:mpah01001]  Serine/threonine kinases: CMGC group   CDK family    110326196 (Cdk4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Haspin_kinase ABC1 Kdo Kinase-like Motif Other DBs NCBI-GeneID:  110326196 NCBI-ProteinID:  XP_021060052 Ensembl:  MGP_PahariEiJ_G0031207 LinkDB All DBs Position 9:complement(50040979..50044840) Genome browser AA seq 304 aa AA seqDB search MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALL RRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDL MRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR EVSLPRGAFVPRGPRPVRSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEES DDAE NT seq 915 nt NT seq  +upstreamnt  +downstreamnt atggctgccactcgatatgaacccgtggctgaaattggtgtcggtgcctatgggacggtg tacaaagcccgagatccccacagtggccactttgtagccctcaagagtgtgagagttcct aatggaggagcagctggagggggccttccggtcagcacagttcgtgaggtggccttgtta aggagactggaggcctttgaacatcccaatgttgtacggctgatggatgtctgtgctact tcccgaactgatcgggacatcaaggtcaccctagtgtttgagcatatagaccaggaccta aggacatatctggacaaagcacctccaccaggcctgccggttgagaccattaaggatctg atgcggcagtttctaagcggcctcgattttcttcatgcaaactgcattgttcaccgggac ctgaaaccagagaacattctagtgacaagtaatgggaccgtcaagctggctgactttggc ctagctagaatctacagctaccagatggccctcacgcctgtggttgttacgctctggtac cgggctcctgaagttcttctgcagtctacgtatgcaacccccgtggacatgtggagcgtt ggctgtattttcgcagagatgtttcgtcggaagcctctcttctgtggaaactctgaagct gaccagttggggaaaatctttgatctcattggattgcctccagaagacgactggcctcga gaggtatccctacctcgaggagcctttgtccccagagggcctcggccagtgcggtcagtg gtgccagagatggaggagtctggagcgcagctgctgctggaaatgctgacctttaaccca cataagcgaatctctgccttccgagccctgcagcactcctacctgcacaaggaggaaagc gacgacgccgagtga

DBGET integrated database retrieval system