KEGG   Methanocella paludicola: MCP_2126Help
Entry
MCP_2126          CDS       T01142                                 

Definition
(GenBank) putative ATP-dependent DNA ligase
Organism
mpd  Methanocella paludicola
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NITE: 
UniProt: 
LinkDB All DBs
Position
complement(2108821..2109825)
Genome map
AA seq 334 aa AA seqDB search
MDPLLERLPPAAKEKLVKMEQPEWEEPMLATLTSKRFDDHGWAFGHKLDGARCLAYRKDG
HVRLMSRTRHEMNASYPEVADALMAQKANDFIIDGEIVALDENGNSKFELLQPRMGLEDP
AEARRTGIPVHYYVFDILFYDGYELTRLPLLERKHILEKTLDYGDTVRFLEDRLGGGLGL
FDEACKKGWEGLIAKRAYGPYVHGRSDEWLKFKCVQNQEFVIGGYTEPHGKRIEFGAILV
GYYQDGKLMYAGKVGTGFDEKTLRSLMDKFRPLERKASPFAEEVREKEVHWLEPKLVAEI
GFEEWTDYGKLRQPRYDGLRYDKDPHSVIREVPK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggaccctctgctggaacgcctgccgcccgcggcaaaggaaaagctggtgaagatggag
cagcctgaatgggaagagccaatgctcgctacccttaccagcaagcgatttgatgaccat
ggctgggcgttcgggcataagctcgacggggcgcggtgcctggcttaccggaaggacggc
cacgtccgcctcatgtcccggacaaggcacgagatgaacgcctcgtacccggaagtagcc
gatgcgctcatggcgcaaaaggcgaatgacttcatcatcgacggcgagatcgtcgccctg
gacgagaacggtaactcgaaattcgagctcttgcagccgcgaatgggcttagaggacccg
gcggaggcccgacgtaccgggatccccgttcattactatgttttcgatatccttttttac
gacggctacgagctgacccggctgccgctcctcgagcgtaagcatatcctggaaaaaact
ctggactacggggatacggtacgtttcctcgaagaccggctgggaggcggattgggactg
ttcgacgaggcatgtaagaaaggctgggaaggcctcatcgccaagcgggcttacggcccc
tatgtccacggccgctccgacgagtggctcaagttcaagtgtgtccagaaccaggagttc
gtcatcggcggctataccgagccccacggcaagcgcatcgagttcggggccattctcgtg
ggctattaccaggatggtaagctgatgtacgcgggcaaagtgggcacgggctttgacgag
aaaacgctgcggagcctcatggataagttccggccgttagagcgtaaggcctcacccttc
gccgaagaggtccgggaaaaggaggtccactggctggagccgaaactcgtggccgagatc
gggttcgaggagtggacggactacggtaagctgcggcagccccgctacgatggcctgcgt
tacgataaggatccgcacagcgtgatccgggaggtgccgaaatga

DBGET integrated database retrieval system