KEGG   Microlunatus phosphovorus: MLP_11820Help
Entry
MLP_11820         CDS       T01535                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mph  Microlunatus phosphovorus
Brite
Enzymes [BR:mph01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MLP_11820 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1295078..1295701)
Genome map
AA seq 207 aa AA seqDB search
MADYVLPDLPYDYSALAPHISGEIMELHHDKHHATYVKGLNTALEQLAEARENNAYGSVG
GLEKTLAFNLGGHINHSVFWPNMSPDGGDKPTGDLAAALDEYFGSFDKFRAHFENVANTI
QGSGWSMLVWDSLGQRLNIVQLYDQQANLPLGQIPIVLLDMWEHAFYLQYKNVKADYVKA
WWNVVNWADAQQRFATAVAQSPGLIKP
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctgactacgtccttcccgatctgccctacgactacagcgcactggcgccgcacatc
tccggcgagatcatggagctgcaccacgacaagcaccacgcgacgtacgtcaagggtctg
aacaccgcgctcgagcagctcgcggaggcccgggagaacaacgcgtacggcagcgtcggt
ggcttggagaagacgctcgccttcaacctgggtggtcacatcaaccactccgtgttctgg
cccaacatgtccccggatggcggcgacaagccgactggtgacctggcggccgcgctcgac
gagtacttcggcagcttcgacaagttccgggcacacttcgagaacgtcgcgaacaccatc
cagggctccggctggtccatgctggtctgggactcactgggtcagcggctgaacatcgtg
cagctctacgatcagcaggccaacctgccgttgggccagatcccgatcgtgctgctcgac
atgtgggagcacgcgttctacctgcagtacaagaacgtcaaggccgactatgtgaaggcc
tggtggaacgtggtcaactgggccgatgcccagcagcggttcgccaccgcggtcgcccag
tcccctggtctgatcaagccctga

DBGET integrated database retrieval system