KEGG   Mycobacterium phlei: MPHLCCUG_02007Help
Entry
MPHLCCUG_02007    CDS       T04305                                 

Definition
(GenBank) Glycogen synthase
  KO
K16150  
glycogen synthase [EC:2.4.1.11]
Organism
mphl  Mycobacterium phlei
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mphl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MPHLCCUG_02007
Enzymes [BR:mphl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MPHLCCUG_02007
Glycosyltransferases [BR:mphl01003]
 Polysaccharide
  Storage polysaccharide
   MPHLCCUG_02007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(2071713..2072954)
Genome map
AA seq 413 aa AA seqDB search
MKVLMVSWEYPPVVVGGLGRHVHHLATALAEAGHEIVVLSRRPTGTDPSTHPTSVEVVEG
VKVVAAAQDPHEFEFGTDMMAWTLAMGHSMIRAGLAIKTAEGEPWQPDVVHAHDWLVAHP
SIALAEFFDVPLVSTIHATEAGRHSGWVSGRISRQVHAVESWLVHESDSLITCSTSMSEE
ITELFGPGLVEIRVIRNGIDCARWPFAQRQPRSGPAQLLYLGRLEYEKGIQDAIAALPRI
RRTHPGTTLTIAGEGTQLEWLKEQARKHKVFKATKFVGHLDHEQLVQLLHTADVAVLPSH
YEPFGIVALEAAATGIPLVTSNVGGLGEAVIDGETGVSYPPRDVAALAAAVRSVLDDPDA
AQRRAVAARERLGSDFEWHSIADETAQVYLASKRREREPHRRRPIVEHALPGR
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttctgatggtttcgtgggagtacccgccggtggtggtgggcggtctgggccgc
cacgtgcatcacctggcgaccgcgctcgccgaggccggccacgagatcgtggtgctcagc
cgtcggcccaccggaaccgacccgtccacccacccgacgagcgttgaggtggtcgagggc
gtcaaagtggttgccgcggcgcaggatccgcacgagttcgagttcggcaccgacatgatg
gcctggacgctggcgatggggcactcgatgatccgggccgggctggcgatcaagaccgcc
gagggcgaaccgtggcagcccgacgtggtgcacgcgcacgactggctggtcgcgcacccg
tcgatcgcgctggccgaattcttcgatgtgccactggtttccacgatccacgccaccgag
gccggccggcactccgggtgggtgtcgggccggatcagccgccaggtgcacgccgtggag
tcgtggctggtgcacgaatccgactcgctgatcacatgttcgacgtcgatgagcgaggag
atcaccgagctgttcggcccgggcctggtcgagatccgggtgatccgcaacgggatcgac
tgtgcgcgctggccgttcgcgcagcgtcagccgagaagcggtccggcgcagctgctctac
ctgggccggctggagtacgagaagggcatccaggacgccatcgccgcgctgccgcggatc
cgtcgcacccatccgggtaccacgctgacgatcgcgggcgagggcacccagctggagtgg
ctcaaggagcaggcgcgcaagcacaaggtcttcaaggcgacgaagttcgtcgggcacctc
gaccacgagcagttggtgcagctgctgcacaccgccgacgtggcggtgctgccgagccac
tacgagccgttcgggatcgtcgcgctggaggccgccgcgaccgggatcccgctggtgacg
tcgaacgtcggcgggctcggcgaagcggtgatcgacggtgagacaggggtgtcgtacccg
ccgcgagacgtggcggcgctggcggcggcggtgcgctcagtgctcgacgatcccgatgcc
gcgcagcggcgggcggtcgccgcgcgggagcggctggggtcggatttcgagtggcactcc
atcgccgacgagaccgcgcaggtttatctggcgtccaaacgccgcgagcgcgagccgcac
cggcgccgcccgatcgtcgagcacgccctcccagggcggtag

DBGET integrated database retrieval system