KEGG   Methylobacterium phyllosphaerae: MCBMB27_04553Help
Entry
MCBMB27_04553     CDS       T04968                                 

Definition
(GenBank) hypothetical protein
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mphy  Methylobacterium phyllosphaerae
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:mphy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MCBMB27_04553
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MCBMB27_04553
   00680 Methane metabolism
    MCBMB27_04553
Enzymes [BR:mphy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MCBMB27_04553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4863071..4865950)
Genome map
AA seq 959 aa AA seqDB search
MQHEPSREPEELEAHLLGLIEAAREQAREDPFRNPVLAVTLAITRRFDRNEISAGDLDGL
FVRLRAEALAARAERLRAYVGLDASPEDPQAGIPARLVAAIPDRSDSVEAFAALIHRTAF
AVVFTAHPTFGMPRAVAGLLAEAASLPDAAARAGLIERAATLSTRPDAPITLDVEFEQAC
AAANNGRLALDAFNGALLDAARARWPDRWTELTPRPFAIASWVGCDTDGRTDIGWWDTLR
YRLISKRMQFDRVMRDLPASPACREVRALAENALAAVNRQLTVAPRLGDQPSLEAVHRFA
LALIIERERAQTDAGALVAALTKALEAADDGADRRRIAVLRAGVATHGLSNALPHFRLNA
SQIHNAVRRVIDLEGEPTDAARRRSHLATIHTLLNDVRPVAVDFGALAAERASAARLMMT
IAQILKHVDGTHPVRFLIAETETGYTLLAALWLARHYGIADKLEITPLFETASALEQGIR
VLDDALRNPHWRQYLKRIGRLTVQFGYSDSGRYVGQLAATFWIERLRLRITEMLVQNGLS
DVELAIFDTHGESIGRGAHPTSLRDRLAYLAPEDARDRARKAGIRVRLESSFQGTDGYLL
YGTEALARASVARIAEHVYALDVTEEDSFSDYALNDHPKAADAKVDPIYAEPDFALEFFT
AARQDMEALVDDPGYAALLGTFGPSLIDRTGSRPVARQTDNGGPARITHPRQMRAIPNNA
ILHQLGFLANSLHGIGRAAQRGPDLFRDMRRDSVRFSRAFRLVQHAASVGDLDVLRAYID
TLDPAVWLERARRTQKDFRRDELVVISGALERLDLAPALRNLFGRLTRDWLALRAAAPDL
PAMSARLTLLHALRLALIHRIWFLAVHIPGFRPQAGISREQLLERFLRLDIDGCLKLLDA
IFPITPDPTLGLNFGEPAGPRDVGTYEAEHANLFQPIRRMFDQVREISGMIQHEVGAFG
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacgagccgagccgcgagcccgaggaactggaggcgcacctcctcggactgatt
gaggcggcccgggaacaggcccgcgaggacccgttccgcaatcccgtcctggcggtaacc
ctggcgatcacccggcggttcgacaggaacgagatctcggcaggcgacctggacggcctg
ttcgtgcgcctgcgcgccgaagccctggcggcccgggcggagcggctgcgggcctatgtc
gggctcgatgccagccccgaggatccgcaggcggggattcccgcccgtctcgtggcggca
atccccgaccggtcggacagcgtcgaggccttcgcggccctcatccaccgcaccgccttc
gcggtggtgttcaccgcccatcccaccttcggcatgccccgggcggtcgccggcctcctc
gccgaggccgcgagcctgcccgacgctgcggcccgcgccgggctgatcgaacgggcggcg
actttgtccacgcggccggacgcgccgatcaccctcgacgtcgagttcgagcaggcctgc
gcggcggccaataacgggcggctcgccctcgacgccttcaacggcgccctgctcgacgcc
gcccgcgcccgctggcccgaccgctggaccgaactgacgccccgccccttcgccatcgcc
agctgggtcggctgcgacacggacgggcggaccgacatcggatggtgggacaccctccgc
taccggctgatctcgaagcggatgcagttcgaccgggtgatgcgcgatctgcccgcgagt
cccgcgtgccgggaggtccgtgccctcgccgagaacgcgctggcagcggtgaaccgccag
ctcaccgtggcgccgcgcctcggcgaccagccgtccctcgaggcggtgcaccgcttcgcc
ctggccctcatcatcgagcgcgagcgcgcccagaccgacgcgggcgccctcgtcgccgcg
ctgaccaaggccctcgaggctgccgacgacggggccgacagacggcggatcgcggtcctg
cgcgcgggcgtcgcgacgcacggcctgtcgaacgccctgccgcatttccggctgaacgcc
agccagatccacaatgcggtacgccgggtgatcgacctcgaaggcgagcccaccgacgcg
gcccggcgccggtcgcacctcgcgacgatccacaccctgctgaacgatgtccggccggtc
gccgtcgatttcggggcgctcgcggccgagcgggcctcggccgcccggctgatgatgacg
atcgcccagatcctcaagcacgtcgacggcacccatccggtgcgcttcctcatcgccgag
accgagaccggctacaccctgctggccgccctctggctggcgcggcactacggcatcgcc
gacaagctggagatcacgccgctgttcgagacggcaagcgccctcgaacagggcattcgg
gtgctcgacgacgccctgcgcaacccccactggcgccagtatctgaagcgcatcggccgg
ctgaccgtgcagttcggctattccgattcgggccgctatgtcggccagcttgcggcgacc
ttctggatcgagcgactgcggctgcgcatcaccgagatgctggtccagaacggcctgtcc
gacgtcgagctcgcgatcttcgacacgcacggcgaatcgatcgggcgcggcgcccatccg
acctccctgcgcgaccgcctcgcctacctcgcccccgaggatgcgcgggaccgggcccgc
aaggccggcatccgggtccggctcgaatcgagcttccagggcaccgacggctacctgctg
tacggcaccgaggcgctggcccgcgccagcgtcgcccgcatcgccgagcacgtctacgcg
ctcgacgtgacggaggaggattcgttctcggactacgccctgaacgaccatcccaaggcg
gccgacgccaaggtcgatccgatctacgccgagccggatttcgccctcgaattcttcacc
gcggcccgccaggacatggaggcgctggtcgacgatccgggctacgccgccctgctcggc
accttcggcccgagcctgatcgaccggaccggctcacgtccggtggcacgccagaccgac
aatggcggcccggcgcggatcacccatccgcgccagatgcgggcgatccccaacaacgcg
atcctgcaccagctcggcttcctggcgaattccctgcacgggatcggccgggccgcccag
cgcggcccggacctgttccgcgacatgcgccgcgattcggtgcgcttctcccgggccttc
cggctggtgcagcacgccgcctcggtgggcgacctcgacgtgctgcgcgcctatatcgac
accctcgatccggccgtgtggctggagcgggcgcggcgcacgcagaaggatttccgcagg
gacgagctggtcgtgatctccggggccctggagcgcctcgatctcgcccccgcgctccgg
aacctgttcggacgcctgacccgcgactggctcgccctgcgcgcggccgccccggacctt
cccgccatgtcggcgcggctgaccctgctccacgccctgcggctcgcgctgatccaccgg
atctggttcctggcggtgcacatcccgggtttccggccccaggcgggcatctcacgcgag
cagctgctggagcgcttcctgcggctggacatcgacggctgcctgaagctcctcgacgcg
atcttcccgatcacgccggatccgacgctcggcctgaacttcggcgagccggccggcccg
cgggacgtcggcacctacgaggcggagcacgccaacctgttccagccgatccgccggatg
ttcgaccaggtccgcgagatctccgggatgatccagcacgaggtcggcgcgttcggatga

DBGET integrated database retrieval system