KEGG   Methanolacinia petrolearia: Mpet_0728Help
Entry
Mpet_0728         CDS       T01312                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mpi  Methanolacinia petrolearia
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mpi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mpet_0728
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mpet_0728
   00680 Methane metabolism
    Mpet_0728
Enzymes [BR:mpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Mpet_0728
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
746381..747850
Genome map
AA seq 489 aa AA seqDB search
MSADYSHVPRCMSTQHPDNVHPPFFAQNPVLEGEDEVVEAYYVYSNLGCDEQMWDCEGKE
VDSFVVKKLLSRYGDYFSERQIGREKFLTLRVPNPEIEHTEGKILLETLESIPRSFDLAS
LFYKNDFAPIFEVILPMTSSFESIDNIYQYYRDFVVGKKDKRLGGRDCTIADWVGDIRPE
KINVIPLFEDMKSILNSDKILRRYIDGKKIDYQRVFFARSDPAMNYGLIGAVLLNKIGLY
KAGAVSEATGVPVLPIIGAGSAPFRGNLRPDTIRRTLAEYPGAWTFTVQSAFKYDYPAED
VRKAVEELKKAPVNPAPEISEERCTDIVERYSAEYNRHLKELAGLVNRVAPYVPQRRKRK
LHIGLFGYSRSSGDIELPRAITFTAAMYSIGVPPEILGLSALKENDMEYLHEVYANFEQD
ILDSLRYLNPESPYIPEGIMEFVGDHFDFETNPDHTNITNKIIADITGNSCFEMQNDILA
AAGIRKFIG
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcagattatagccatgttccgagatgcatgagcacccagcatccggacaacgtt
cacccgcctttctttgcccaaaaccctgtacttgagggtgaagacgaggtggttgaggcc
tattacgtctattcaaatctcgggtgcgacgagcagatgtgggactgcgaggggaaggaa
gtcgatagtttcgttgtaaaaaaactcctttcgagatacggtgattatttcagcgagaga
cagatcggcagggaaaaattccttacactgagagttccgaaccctgagatcgagcatacc
gagggaaagatcctgcttgagactctcgaaagcatcccgagatcgttcgacctggcaagt
ctgttctataaaaacgacttcgccccgatatttgaggtaatcctcccgatgacctcttca
ttcgaatcgatcgacaacatctaccagtattaccgtgattttgtcgtaggcaagaaggac
aagcgtcttggcggccgtgattgcacgattgccgactgggtgggcgacatcaggccggaa
aagataaacgtaattccgcttttcgaggatatgaagagcatcctcaattcggataagata
ctcaggcgttatatcgacggcaaaaaaattgattaccagagggtcttcttcgcccgctcc
gatccagcaatgaattacgggctgatcggcgcagtcctcctgaacaagattggcctctat
aaagccggtgcagtttccgaagcgactggtgttcctgttctcccgatcatcggtgcaggc
tccgctccgttcaggggaaacctcaggcctgatacgatccggcggacacttgccgaatac
ccgggagcatggaccttcactgtccagtccgcattcaagtacgactacccggcggaagat
gtgcgaaaagcagtggaagaacttaaaaaagcgcctgtaaaccctgcgcctgagatctca
gaagaaaggtgcacagatattgtagaacgctactctgcggagtacaacaggcacctgaaa
gagcttgcaggactcgtcaacagggttgcaccctatgtacctcagaggaggaagcggaag
ctccatataggactcttcggttactccaggtcttccggcgacatcgaacttccgagggca
atcacattcacggcggcgatgtattctatcggagttccacctgagattctcggcctgtcc
gcattaaaagagaacgatatggaatatctccatgaagtctacgcgaacttcgaacaggac
attctcgattcactgagatacctgaaccctgaatcgccctatattcctgaaggcataatg
gaatttgtcggcgatcatttcgatttcgaaacgaacccggatcatacgaatatcacgaat
aaaatcatcgccgatataacaggcaacagctgcttcgagatgcagaacgacattctcgcc
gctgcaggaatcaggaaattcatcggataa

DBGET integrated database retrieval system