KEGG   Micromonas pusilla: MICPUCDRAFT_37117Help
Entry
MICPUCDRAFT_37117 CDS       T02696                                 

Definition
(RefSeq) hypothetical protein
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mpp  Micromonas pusilla
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mpp00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MICPUCDRAFT_37117
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    MICPUCDRAFT_37117
Enzymes [BR:mpp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MICPUCDRAFT_37117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
AA seq 204 aa AA seqDB search
MAALCSVAPVVAKVPAVSTGKASKSSAMQVWNPTNNKFFETFSFLPPLSDQEIARQVQYL
INNGWAPCIEFEGAGKAYCDTHGWSGLDSSVNAGYYDNRYWVMWKLPMYGCTSPDEVLAE
VRACTRAFPDCFIRVAGFDNIKQVQCSSFLAHRPANDRTFQPVTGRQVGDGSDGRAAPAA
PSGGGDSGMSGGFTPKPPQQNYSW
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggctgctctctgctccgtcgcgcccgtcgtggccaaggtccccgccgtctccaccggc
aaggcctccaagtcctccgcgatgcaggtctggaacccgacgaacaacaagttcttcgag
accttctccttcctcccccccctctccgaccaggagatcgcccgccaggtccagtacctc
atcaacaacggctgggctccctgcatcgagttcgagggtgccggcaaggcgtactgcgac
acccacggctggtccggcctcgactcctccgtcaacgcgggctactacgataaccgctac
tgggtgatgtggaagctccccatgtacggctgcacctccccggatgaggtcctcgccgag
gtccgcgcgtgcacccgcgcgttccccgactgcttcattcgcgtcgcgggtttcgacaac
atcaagcaggtccagtgctcctccttcctcgcgcaccgcccggcgaacgaccgcaccttc
cagccggtgaccggccgccaggtcggcgacggcagcgacggccgcgcggcgccggcggcc
ccgtccggcggcggtgacagcggcatgtccggcggcttcacccccaagcccccccagcag
aactactcctggtaa

DBGET integrated database retrieval system