KEGG   Methylibium petroleiphilum: Mpe_A2783Help
Entry
Mpe_A2783         CDS       T00470                                 

Gene name
cbbS
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mpt  Methylibium petroleiphilum
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:mpt00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mpe_A2783 (cbbS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mpe_A2783 (cbbS)
Enzymes [BR:mpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Mpe_A2783 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2965036..2965455
Genome map
AA seq 139 aa AA seqDB search
MRITQGTFSFLPDLSDEQISRQVSYCLDKGWAIGLEYTDDPHPRNTYWEMFGNPMFDVQD
AAGVMLEVKSCRKTFPNHYIRLTAFDSSHGTESVVLSFIINRPSEEPGFRLIRTEEPGRT
LRYSIESYAVQAAAEGARY
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcacacaaggcaccttctccttcctgcccgacctgagcgacgagcagatcagc
cgtcaggtcagctactgcctcgacaagggctgggccatcggcctcgaatacaccgacgac
ccccatccccgcaacacctactgggagatgttcggcaacccgatgttcgacgtgcaggac
gccgccggcgtcatgctcgaggtcaagagctgccgcaagaccttcccgaaccactacatc
cgcctgaccgcgttcgactcgtcgcacggcaccgagtcggtggtgctgtctttcatcatc
aaccgccccagcgaggagcccggtttccgcctgatccgtaccgaggagccgggccgcacc
ttgcgctacagcatcgagagctacgcggtccaggccgccgcggaaggcgcacgctactga

DBGET integrated database retrieval system