Mustela putorius furo (domestic ferret): 101671559 Help Entry 101671559         CDS       T07239                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf04015   Rap1 signaling pathway mpuf04810   Regulation of actin cytoskeleton mpuf05014   Amyotrophic lateral sclerosis mpuf05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     101671559 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     101671559 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     101671559 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     101671559 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpuf04131]     101671559 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mpuf04812]     101671559 (PFN1)    04147 Exosome [BR:mpuf04147]     101671559 (PFN1) Membrane trafficking [BR:mpuf04131]  Others   Actin-binding proteins    Others     101671559 (PFN1) Cytoskeleton proteins [BR:mpuf04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      101671559 (PFN1) Exosome [BR:mpuf04147]  Exosomal proteins   Proteins found in most exosomes    101671559 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  101671559 NCBI-ProteinID:  XP_004760496 UniProt:  A0A8U0SA05 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFF VNGLTLGGQKCSVIRDSLLQDGEFTMDLRTKSTGGAPTFNITVTMTAKTLVLLMGKEGVH GGMINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg gccatcgtgggctataaggactcgccctccgtctgggccgccgtccccgggaagaccttc gtcaacatcacgccagctgaggttggtgtcctggttggcaaagaccggtcaagttttttc gtgaacgggctgacacttgggggccagaaatgttctgttatccgggactcactgctgcag gatggggagtttaccatggaccttcgtaccaagagcaccggtggagcccccactttcaac atcactgtcaccatgactgccaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtatgatcaacaagaaatgttatgaaatggcctcccacctgcggcgttcccagtac tga

DBGET integrated database retrieval system