Mustela putorius furo (domestic ferret): 101680239 Help Entry 101680239         CDS       T07239                                  Symbol RELA Name (RefSeq) transcription factor p65   KO K04735   transcription factor p65 Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf01523   Antifolate resistance mpuf04010   MAPK signaling pathway mpuf04014   Ras signaling pathway mpuf04024   cAMP signaling pathway mpuf04062   Chemokine signaling pathway mpuf04064   NF-kappa B signaling pathway mpuf04066   HIF-1 signaling pathway mpuf04071   Sphingolipid signaling pathway mpuf04137   Mitophagy - animal mpuf04151   PI3K-Akt signaling pathway mpuf04210   Apoptosis mpuf04211   Longevity regulating pathway mpuf04218   Cellular senescence mpuf04380   Osteoclast differentiation mpuf04613   Neutrophil extracellular trap formation mpuf04620   Toll-like receptor signaling pathway mpuf04621   NOD-like receptor signaling pathway mpuf04622   RIG-I-like receptor signaling pathway mpuf04623   Cytosolic DNA-sensing pathway mpuf04625   C-type lectin receptor signaling pathway mpuf04657   IL-17 signaling pathway mpuf04658   Th1 and Th2 cell differentiation mpuf04659   Th17 cell differentiation mpuf04660   T cell receptor signaling pathway mpuf04662   B cell receptor signaling pathway mpuf04668   TNF signaling pathway mpuf04722   Neurotrophin signaling pathway mpuf04917   Prolactin signaling pathway mpuf04920   Adipocytokine signaling pathway mpuf04926   Relaxin signaling pathway mpuf04931   Insulin resistance mpuf04932   Non-alcoholic fatty liver disease mpuf04933   AGE-RAGE signaling pathway in diabetic complications mpuf04936   Alcoholic liver disease mpuf05010   Alzheimer disease mpuf05022   Pathways of neurodegeneration - multiple diseases mpuf05030   Cocaine addiction mpuf05132   Salmonella infection mpuf05133   Pertussis mpuf05134   Legionellosis mpuf05135   Yersinia infection mpuf05140   Leishmaniasis mpuf05142   Chagas disease mpuf05145   Toxoplasmosis mpuf05146   Amoebiasis mpuf05152   Tuberculosis mpuf05160   Hepatitis C mpuf05161   Hepatitis B mpuf05162   Measles mpuf05163   Human cytomegalovirus infection mpuf05164   Influenza A mpuf05165   Human papillomavirus infection mpuf05166   Human T-cell leukemia virus 1 infection mpuf05167   Kaposi sarcoma-associated herpesvirus infection mpuf05168   Herpes simplex virus 1 infection mpuf05169   Epstein-Barr virus infection mpuf05170   Human immunodeficiency virus 1 infection mpuf05171   Coronavirus disease - COVID-19 mpuf05200   Pathways in cancer mpuf05202   Transcriptional misregulation in cancer mpuf05203   Viral carcinogenesis mpuf05207   Chemical carcinogenesis - receptor activation mpuf05208   Chemical carcinogenesis - reactive oxygen species mpuf05212   Pancreatic cancer mpuf05215   Prostate cancer mpuf05220   Chronic myeloid leukemia mpuf05221   Acute myeloid leukemia mpuf05222   Small cell lung cancer mpuf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mpuf05321   Inflammatory bowel disease mpuf05415   Diabetic cardiomyopathy mpuf05417   Lipid and atherosclerosis mpuf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101680239 (RELA)    04014 Ras signaling pathway     101680239 (RELA)    04064 NF-kappa B signaling pathway     101680239 (RELA)    04668 TNF signaling pathway     101680239 (RELA)    04066 HIF-1 signaling pathway     101680239 (RELA)    04071 Sphingolipid signaling pathway     101680239 (RELA)    04024 cAMP signaling pathway     101680239 (RELA)    04151 PI3K-Akt signaling pathway     101680239 (RELA)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     101680239 (RELA)   09143 Cell growth and death    04210 Apoptosis     101680239 (RELA)    04218 Cellular senescence     101680239 (RELA)  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101680239 (RELA)    04620 Toll-like receptor signaling pathway     101680239 (RELA)    04621 NOD-like receptor signaling pathway     101680239 (RELA)    04622 RIG-I-like receptor signaling pathway     101680239 (RELA)    04623 Cytosolic DNA-sensing pathway     101680239 (RELA)    04625 C-type lectin receptor signaling pathway     101680239 (RELA)    04660 T cell receptor signaling pathway     101680239 (RELA)    04658 Th1 and Th2 cell differentiation     101680239 (RELA)    04659 Th17 cell differentiation     101680239 (RELA)    04657 IL-17 signaling pathway     101680239 (RELA)    04662 B cell receptor signaling pathway     101680239 (RELA)    04062 Chemokine signaling pathway     101680239 (RELA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     101680239 (RELA)    04917 Prolactin signaling pathway     101680239 (RELA)    04926 Relaxin signaling pathway     101680239 (RELA)   09156 Nervous system    04722 Neurotrophin signaling pathway     101680239 (RELA)   09158 Development and regeneration    04380 Osteoclast differentiation     101680239 (RELA)   09149 Aging    04211 Longevity regulating pathway     101680239 (RELA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101680239 (RELA)    05202 Transcriptional misregulation in cancer     101680239 (RELA)    05207 Chemical carcinogenesis - receptor activation     101680239 (RELA)    05208 Chemical carcinogenesis - reactive oxygen species     101680239 (RELA)    05203 Viral carcinogenesis     101680239 (RELA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101680239 (RELA)   09162 Cancer: specific types    05212 Pancreatic cancer     101680239 (RELA)    05221 Acute myeloid leukemia     101680239 (RELA)    05220 Chronic myeloid leukemia     101680239 (RELA)    05215 Prostate cancer     101680239 (RELA)    05222 Small cell lung cancer     101680239 (RELA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101680239 (RELA)    05170 Human immunodeficiency virus 1 infection     101680239 (RELA)    05161 Hepatitis B     101680239 (RELA)    05160 Hepatitis C     101680239 (RELA)    05171 Coronavirus disease - COVID-19     101680239 (RELA)    05164 Influenza A     101680239 (RELA)    05162 Measles     101680239 (RELA)    05168 Herpes simplex virus 1 infection     101680239 (RELA)    05163 Human cytomegalovirus infection     101680239 (RELA)    05167 Kaposi sarcoma-associated herpesvirus infection     101680239 (RELA)    05169 Epstein-Barr virus infection     101680239 (RELA)    05165 Human papillomavirus infection     101680239 (RELA)   09171 Infectious disease: bacterial    05132 Salmonella infection     101680239 (RELA)    05135 Yersinia infection     101680239 (RELA)    05133 Pertussis     101680239 (RELA)    05134 Legionellosis     101680239 (RELA)    05152 Tuberculosis     101680239 (RELA)   09174 Infectious disease: parasitic    05146 Amoebiasis     101680239 (RELA)    05145 Toxoplasmosis     101680239 (RELA)    05140 Leishmaniasis     101680239 (RELA)    05142 Chagas disease     101680239 (RELA)   09163 Immune disease    05321 Inflammatory bowel disease     101680239 (RELA)   09164 Neurodegenerative disease    05010 Alzheimer disease     101680239 (RELA)    05022 Pathways of neurodegeneration - multiple diseases     101680239 (RELA)   09165 Substance dependence    05030 Cocaine addiction     101680239 (RELA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101680239 (RELA)    05418 Fluid shear stress and atherosclerosis     101680239 (RELA)    05415 Diabetic cardiomyopathy     101680239 (RELA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     101680239 (RELA)    04932 Non-alcoholic fatty liver disease     101680239 (RELA)    04931 Insulin resistance     101680239 (RELA)    04933 AGE-RAGE signaling pathway in diabetic complications     101680239 (RELA)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     101680239 (RELA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mpuf03000]     101680239 (RELA) Transcription factors [BR:mpuf03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Rel/Ankyrin     101680239 (RELA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RHD_DNA_bind RHD_dimer Motif Other DBs NCBI-GeneID:  101680239 NCBI-ProteinID:  XP_004770500 Ensembl:  ENSMPUG00000011637 LinkDB All DBs Position Unknown AA seq 594 aa AA seqDB search MVVAKPLQGAGPDSVPFGGREPGSTSSLRGEGRQALPGKVGKWACADPCLPPLSDLFPLI FPSEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTG PGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQ AISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPAGRPLRLSPVLSHPIFDNRA PNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQV AIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYET FKSIMKKSPFNGPTDPRPPPRRIAVPSRSTTSVPKPAPQPYPFTPSLSTINFEEFSPMVF PSGQIPNQTPALAPAPAPILAPVPAPAPAPAPILAPPGLAQPVAPPAPKTAQAGEGTLSE ALLQLQFDADEDLGALLGSSADPAVFTDLACVDNSEFQQLLNQGVSAAPHTAEPMLMEYP EAITRLVTGSQRPPDPAPAPLGASGLPNGLLSGDEDFSSIADMDFSALLSQISS NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt atggtagtggccaagccactgcagggagcaggccctgactcagtgcccttcggagggagg gagcctggctccacgtcctctctgaggggcgaggggcggcaggccctgcctggtaaggtt gggaagtgggcttgcgctgacccctgtctccctcccctttcagacctgtttcccctcatc ttcccgtctgagcctgcgcaggcctctggcccctatgtggagatcatcgagcagcccaag cagcggggaatgcgcttccgctacaagtgcgagggccgctcagcgggcagtatcccaggc gagaggagcacggataccaccaagacccatcccaccatcaagatcaatggctacacgggg ccggggacagttcgcatctctctggtcaccaaagacccccctcaccggcctcacccccat gagcttgtggggaaagactgccgggatggcttctatgaggctgagctctgcccagaccgc tgcatccacagcttccagaacctggggatccagtgtgtaaagaagcgggacctggagcag gccatcagtcaacgcatccagaccaataacaatcccttccaagttcccatagaagaacag cgtggggactatgacctgaacgcagtgcggctctgcttccaggtgacagtgcgggacccg gcaggcaggcccctccgcttgtcacccgtcctctctcatcccatttttgacaaccgcgcc cccaacactgctgagctcaagatctgccgggtgaaccggaactccgggagctgcctcggc ggggatgagatcttcctgctgtgtgacaaggtgcagaaagaggacattgaagtgtatttc acgggaccaggctgggaggcccgaggctccttttcacaagctgacgtccaccgacaagtg gccattgtattccggacacctccctacgcggaccccagcctgcaggcccccgtgcgtgtc tccatgcagctgcggcggccttcagatcgggagctcagtgagcccatggagttccagtac ttgccagacacagatgatcgtcaccggattgaggagaagcgcaaaaggacatacgagacc ttcaagagcatcatgaagaaaagtcccttcaatggacccactgaccccaggcctccgccc cggcgcattgcggtgccttcccgaagcacaacttccgtccccaagccagctccccagccc tatccctttacgccatccctcagcaccatcaacttcgaggagttctcccccatggtcttt ccttcggggcagattccaaaccagacccctgccttggcaccggcccctgcccccatcctg gccccggtcccagccccggccccagccccggccccaatcttagcccccccgggcctcgct cagcctgtggccccccccgcccccaagaccgcccaggccggggaagggacactgtcggag gccctgctgcagctgcagtttgacgctgacgaagacctgggggccctgctgggcagcagc gctgaccccgccgtgttcacagacctggcatgcgtcgacaactcggagtttcagcagctg ctgaaccaaggtgtatctgcggccccacacacagccgagcccatgctgatggagtaccct gaggcaataactcgcctggtgacagggtcccagaggccccccgacccagctcctgctccc ctgggggcctctgggctccccaacggcctcctctcaggggatgaagacttctcctccatc gcagacatggacttctcagccctcctgagtcagatcagctcctaa

DBGET integrated database retrieval system