Mustela putorius furo (domestic ferret): 101680348 Help Entry 101680348         CDS       T07239                                  Symbol JUN Name (RefSeq) transcription factor AP-1   KO K04448   transcription factor AP-1 Organism mpuf  Mustela putorius furo (domestic ferret) Pathway mpuf01522   Endocrine resistance mpuf04010   MAPK signaling pathway mpuf04012   ErbB signaling pathway mpuf04024   cAMP signaling pathway mpuf04137   Mitophagy - animal mpuf04210   Apoptosis mpuf04310   Wnt signaling pathway mpuf04380   Osteoclast differentiation mpuf04510   Focal adhesion mpuf04530   Tight junction mpuf04620   Toll-like receptor signaling pathway mpuf04621   NOD-like receptor signaling pathway mpuf04625   C-type lectin receptor signaling pathway mpuf04657   IL-17 signaling pathway mpuf04658   Th1 and Th2 cell differentiation mpuf04659   Th17 cell differentiation mpuf04660   T cell receptor signaling pathway mpuf04662   B cell receptor signaling pathway mpuf04668   TNF signaling pathway mpuf04722   Neurotrophin signaling pathway mpuf04912   GnRH signaling pathway mpuf04915   Estrogen signaling pathway mpuf04921   Oxytocin signaling pathway mpuf04926   Relaxin signaling pathway mpuf04932   Non-alcoholic fatty liver disease mpuf04933   AGE-RAGE signaling pathway in diabetic complications mpuf05030   Cocaine addiction mpuf05031   Amphetamine addiction mpuf05132   Salmonella infection mpuf05133   Pertussis mpuf05135   Yersinia infection mpuf05140   Leishmaniasis mpuf05142   Chagas disease mpuf05161   Hepatitis B mpuf05162   Measles mpuf05166   Human T-cell leukemia virus 1 infection mpuf05167   Kaposi sarcoma-associated herpesvirus infection mpuf05169   Epstein-Barr virus infection mpuf05170   Human immunodeficiency virus 1 infection mpuf05171   Coronavirus disease - COVID-19 mpuf05200   Pathways in cancer mpuf05203   Viral carcinogenesis mpuf05207   Chemical carcinogenesis - receptor activation mpuf05208   Chemical carcinogenesis - reactive oxygen species mpuf05210   Colorectal cancer mpuf05211   Renal cell carcinoma mpuf05224   Breast cancer mpuf05231   Choline metabolism in cancer mpuf05235   PD-L1 expression and PD-1 checkpoint pathway in cancer mpuf05321   Inflammatory bowel disease mpuf05323   Rheumatoid arthritis mpuf05417   Lipid and atherosclerosis mpuf05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpuf00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101680348 (JUN)    04012 ErbB signaling pathway     101680348 (JUN)    04310 Wnt signaling pathway     101680348 (JUN)    04668 TNF signaling pathway     101680348 (JUN)    04024 cAMP signaling pathway     101680348 (JUN)  09140 Cellular Processes   09141 Transport and catabolism    04137 Mitophagy - animal     101680348 (JUN)   09143 Cell growth and death    04210 Apoptosis     101680348 (JUN)   09144 Cellular community - eukaryotes    04510 Focal adhesion     101680348 (JUN)    04530 Tight junction     101680348 (JUN)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     101680348 (JUN)    04621 NOD-like receptor signaling pathway     101680348 (JUN)    04625 C-type lectin receptor signaling pathway     101680348 (JUN)    04660 T cell receptor signaling pathway     101680348 (JUN)    04658 Th1 and Th2 cell differentiation     101680348 (JUN)    04659 Th17 cell differentiation     101680348 (JUN)    04657 IL-17 signaling pathway     101680348 (JUN)    04662 B cell receptor signaling pathway     101680348 (JUN)   09152 Endocrine system    04912 GnRH signaling pathway     101680348 (JUN)    04915 Estrogen signaling pathway     101680348 (JUN)    04921 Oxytocin signaling pathway     101680348 (JUN)    04926 Relaxin signaling pathway     101680348 (JUN)   09156 Nervous system    04722 Neurotrophin signaling pathway     101680348 (JUN)   09158 Development and regeneration    04380 Osteoclast differentiation     101680348 (JUN)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101680348 (JUN)    05207 Chemical carcinogenesis - receptor activation     101680348 (JUN)    05208 Chemical carcinogenesis - reactive oxygen species     101680348 (JUN)    05203 Viral carcinogenesis     101680348 (JUN)    05231 Choline metabolism in cancer     101680348 (JUN)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101680348 (JUN)   09162 Cancer: specific types    05210 Colorectal cancer     101680348 (JUN)    05211 Renal cell carcinoma     101680348 (JUN)    05224 Breast cancer     101680348 (JUN)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101680348 (JUN)    05170 Human immunodeficiency virus 1 infection     101680348 (JUN)    05161 Hepatitis B     101680348 (JUN)    05171 Coronavirus disease - COVID-19     101680348 (JUN)    05162 Measles     101680348 (JUN)    05167 Kaposi sarcoma-associated herpesvirus infection     101680348 (JUN)    05169 Epstein-Barr virus infection     101680348 (JUN)   09171 Infectious disease: bacterial    05132 Salmonella infection     101680348 (JUN)    05135 Yersinia infection     101680348 (JUN)    05133 Pertussis     101680348 (JUN)   09174 Infectious disease: parasitic    05140 Leishmaniasis     101680348 (JUN)    05142 Chagas disease     101680348 (JUN)   09163 Immune disease    05323 Rheumatoid arthritis     101680348 (JUN)    05321 Inflammatory bowel disease     101680348 (JUN)   09165 Substance dependence    05030 Cocaine addiction     101680348 (JUN)    05031 Amphetamine addiction     101680348 (JUN)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101680348 (JUN)    05418 Fluid shear stress and atherosclerosis     101680348 (JUN)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     101680348 (JUN)    04933 AGE-RAGE signaling pathway in diabetic complications     101680348 (JUN)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     101680348 (JUN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:mpuf03000]     101680348 (JUN) Transcription factors [BR:mpuf03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Jun     101680348 (JUN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha FlaC_arch DUF3450 TFIIA NYD-SP28_assoc Motif Other DBs NCBI-GeneID:  101680348 NCBI-ProteinID:  XP_004751694 Ensembl:  ENSMPUG00000020182 UniProt:  M3Z8Y3 LinkDB All DBs Position Unknown AA seq 334 aa AA seqDB search MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE LHSQNTLPSVTSAAQPVSGAGMVAPAVASAAGGSGSGGFSASLHSEPPVYANLSNFNPGA LSGGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQLPVQHPRLQALKEEPQTVPEMPG ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt atgactgcaaagatggaaacgaccttctacgacgatgccctgaatgcctcgttcctccag tctgagagcggcgcctacggctacagtaaccccaagatcctgaaacagagtatgaccctg aatctggccgacccggtgggtagcctgaagccgcacctccgggccaagaactcggacctc ctcacctcgcccgacgtggggctgctcaagctagcctcgcccgagctggagcgcctgata atccagtccagcaacgggcacatcaccaccacgccgacccccacgcagttcttgtgcccc aagaacgtgacagacgagcaggagggcttcgccgagggtttcgtgcgcgccctggccgaa ctgcacagccagaacacgctgcccagcgtcacgtcggcagcgcagccggtcagcggggcg ggcatggtggctccggcggtggcctcggcggcgggtggcagcggcagcggcggcttcagt gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccgggcgcg ctgagcggcggcggcggggcgccctcctacggcgctgccggcctggcctttcccgcgcaa ccccagcagcagcagcagcccccgcagccgccgcaccacctgccccagcagctccccgtg cagcacccgcggctgcaggccttgaaggaggagccgcagacggtgcccgagatgcccggg gaaacgccgcccttgtcccccatcgacatggagtcgcaggagaggatcaaggcagagagg aagcgcatgaggaaccgcatagctgcctccaagtgccggaaaaggaagctggagaggatc gcccggctggaggaaaaagtgaaaaccttgaaagcgcagaactcggagctggcgtccacg gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system