KEGG   Marinitoga piezophila: Marpi_0543Help
Entry
Marpi_0543        CDS       T01665                                 

Definition
(GenBank) glycosidase
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
mpz  Marinitoga piezophila
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Marpi_0543
Enzymes [BR:mpz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Marpi_0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(542243..544081)
Genome map
AA seq 612 aa AA seqDB search
MKKLVVTFVFMFFLSFFFILNGCVNQTLKTSYHEKKQILKEVKSEWGNAYFRGTPNNWGI
THMSKIGPHTWQIIIKFNNGDGYGKPRFKIDHFGDWKESYPANDYEVEPYTTYKITFYDD
THYIKVEKYIKAVNGVMLQAFQWYLPEYNEKTKSGLWVELSKKIPDLALMGITALWLPPA
YKGQAGKSDVGYGVYDLYDLGEFNQKGTISTKYGTKEQYLKLIENAHLYNIQVYGDIVFN
HKMGADNTEWVNATKVSWNNRNIEIENKTIKAWTLFNFPGRNNKYSDFKWRWYHFDGVDW
DQNTGEKAIFRFNGIGKAWDWEVDDENFNYDYLMGADLDMDHPEVVQELKKWGKWYVNFT
KIDGFRLDAVKHIKFSFFNDWLDYMRNVLGKELFTVGEYWSTDINKLENYISKTEGRMSL
FDVPLHQHFYEASNSGGYYDMRNIFNGTLVQKNPIKAVTFVENHDTQPGQSLSSPVQDWF
KPLAYAMILLRKDGYPCVFYGDMYGAPGIKEQYGTIKKLIEARKLYSYGKQYDYLDHQDI
IGWTRLGDEEHPKSMAVILSDGPGGSKWMYVGKKKTKFIDLLGNIKEEIWTNDYGWAEFK
VNGGSVSVWVEE
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttagtggtaacttttgtttttatgttttttttatctttttttttcatttta
aatggatgtgttaaccaaactctgaaaacatcatatcatgaaaagaaacaaattttaaaa
gaagttaaaagtgaatgggggaatgcatattttagaggcacaccaaacaattggggaatt
actcatatgtctaaaataggtcctcatacatggcaaattataattaaatttaataatgga
gatggttatggaaaaccaagatttaagatagatcattttggtgattggaaagaaagttat
cccgctaatgattatgaagttgaaccttacaccacttataaaataactttttatgatgat
actcattatataaaagttgaaaaatatataaaagctgtaaatggtgtaatgctacaggcc
tttcaatggtatttgccagaatataatgagaaaaccaaaagcggattatgggtagagtta
tcaaaaaaaattccagatttagccttaatggggataacggcattatggcttccaccagca
tataaagggcaggcaggaaaaagtgatgtggggtatggagtctatgatttgtatgatctt
ggagaattcaatcaaaaaggtactatttcaacaaaatacggaacgaaagaacaatattta
aaattaattgaaaatgcccatttatataatatacaggtttatggcgatattgtatttaat
cataaaatgggagcagataatacagaatgggttaatgcaacaaaagtttcatggaataat
aggaatattgaaattgaaaataaaacaataaaagcatggacactttttaattttccagga
cgaaataataaatattcagattttaaatggagatggtatcattttgatggtgtagattgg
gatcaaaacactggtgaaaaagctatattcaggtttaatggaattggaaaggcatgggat
tgggaagtggatgatgaaaattttaattatgattatttaatgggtgcagatcttgatatg
gatcatcctgaagttgtacaagaacttaaaaaatggggtaaatggtatgttaattttaca
aaaattgatggatttagattagatgctgtaaaacacataaaatttagtttttttaatgat
tggctggattatatgagaaatgtattaggaaaagaattatttacagttggagaatattgg
agtacagatattaataaactagaaaattatatatcaaaaacagaaggtagaatgtctctc
tttgatgttccattgcatcaacatttttacgaggcatcgaattctgggggctattatgac
atgagaaatatttttaatggaacacttgttcagaaaaatcctataaaagctgttactttt
gttgaaaatcatgacacacagcctggtcagtctttatcttctcctgtacaggattggttt
aaacctttagcttatgcaatgattctattgcgaaaagatggttatccatgtgttttttat
ggggatatgtatggtgctcctggaataaaagaacaatatgggacaattaaaaaacttatt
gaagcaagaaagttatattcatatggaaagcaatatgattatttagatcaccaagacata
attggttggacaagattgggagacgaagaacacccaaaaagcatggcagtaatactttcg
gatggtcctggtggaagcaaatggatgtatgttggaaagaaaaaaacaaagtttatagat
ttgctggggaatataaaagaggaaatttggacaaatgattatggatgggcagaatttaaa
gttaatggaggttctgtctctgtttgggtagaagaataa

DBGET integrated database retrieval system