KEGG   Methylobacterium radiotolerans: Mrad2831_2216Help
Entry
Mrad2831_2216     CDS       T00674                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
mrd  Methylobacterium radiotolerans
Brite
Translation factors [BR:mrd03012]
 Eukaryotic Type
  Elongation factors
   Mrad2831_2216
 Prokaryotic Type
   Mrad2831_2216
Mitochondrial biogenesis [BR:mrd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Mrad2831_2216
Exosome [BR:mrd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Mrad2831_2216
  Exosomal proteins of breast cancer cells
   Mrad2831_2216
  Exosomal proteins of colorectal cancer cells
   Mrad2831_2216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
2354156..2355346
Genome map
AA seq 396 aa AA seqDB search
MGKEKFSRTKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETQNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDMVDDEELLELVELEVRELLSKYDFPGDDIPITKGSALMALE
DKEPKIGKEAVLALMATVDAYIPQPERPIDMPFLMPIEDVFSISGRGTVVTGRVERGIVK
VGEEVEIVGIRATTKTTVTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVVCKPGS
VKPHSKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGICTLPEGTEMVMPGDNVT
MDVALIVPVAMEEKLRFAIREGGRTVGAGVVAAIND
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggaaaagttctcccgcaccaagccgcactgcaacattggcacgatcggccac
gtcgatcacggcaagacgtctctgacggcggcgatcacgaaggttctggccgagacgggc
ggggcgacgttcacggcctacgaccagatcgacaaggcgcctgaggagaaggcgcgcggg
atcacgatctcgacggcgcacgtggagtacgagacgcagaaccgtcactacgcgcacgtc
gactgccccggccacgccgactacgtgaagaacatgatcacgggcgcggcgcagatggac
ggcgcgatcctggttgtgtcggcggccgacggcccgatgccgcagacccgcgagcacatc
ctgctggcccgccaggtcggcgtgccggcgctggtggtgttcctcaacaaggtcgacatg
gtcgacgacgaggagctgctggagctggtcgagctcgaggtgcgcgagctgctgtcgaag
tacgacttccccggcgacgacatcccgatcaccaagggctcggcgctgatggcgctcgag
gacaaggagccgaagatcggcaaggaggcggtcctggcgctgatggcgaccgtggacgcc
tacatcccgcagccggagcgtccgatcgacatgccgttcctgatgccgatcgaggacgtg
ttctcgatctcgggccgcggcacggtggtgacgggtcgcgtcgagcgcggcatcgtgaag
gtgggcgaggaagttgagatcgtcggcatccgggcgaccaccaagacgacggtgaccggc
gtcgagatgttccgcaagctgctcgaccagggccaggcgggcgacaacgtcggcgtgctg
ctgcgcggcacgaagcgcgaggacgtggagcgcggccaggtggtgtgcaagccgggttcg
gtgaagccgcactcgaagttcaaggccgaggcgtacatcctgaccaaggaggagggcggc
cgccacacgccgttcttcaccaactaccggccgcagttctacttccggaccacggacgtg
accgggatctgcacgctccccgagggcaccgagatggtgatgccgggcgacaacgtgacc
atggacgtggcgctgatcgtgccggtggccatggaggagaagctgcgcttcgccatccgc
gagggcggccgtaccgtcggcgccggcgtcgtcgccgccatcaacgactga

DBGET integrated database retrieval system