KEGG   Moniliophthora roreri: Moror_15309Help
Entry
Moror_15309       CDS       T03137                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
mrr  Moniliophthora roreri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Moror_15309
Enzymes [BR:mrr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Moror_15309
Glycosyltransferases [BR:mrr01003]
 Polysaccharide
  Storage polysaccharide
   Moror_15309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 762 aa AA seqDB search
MSATTMSATTISATTSEKRDVQNPLLFECAWEVANKVGGIYTVIKTKVPVTVSEYGDRYC
LIGPLSYKTAPMEVEQQEPTDPHLAATLENMRSQGVKALYGRWLIEGAPRVLLFDTGSQY
SRLDEWKADLWNLAGIPSPPNDHETNETIVFGYLVAWFLGDYVSRQLTTAVVAHFHEWQA
GLAIPLCRKRHIDVTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCI
ERSAAHCADVFTTVSHITAYESEHLLKRKPDGVLPNGLNVVKFQAMHEFQNMHSTSKAKI
NEFVRGHFYGHYDFDLDNTLYMFTAGRYEYRNKGVDMFIESLARLNYRLQKAGSTVTVIA
FIIMPATTNSYTIEALKGQAVTKQLRDTVTEIQNRIGARLFDHAARFHGDTKAIPTTDDL
LSPEDQVLLKRRIFALKRNSLPPVTTHNMADDANDPILNQIRRVKLFNNNHDRVKVVFHP
DFLNANNPILGMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGCFMQ
DLIERPQDEGCYIVDRRMQSVEDSVNQLTDHMFSFCSKTRRQRINQRNRVERLSPLLDWK
NLGIEYSKSRQLALRRAYPDQFYGPAGDPYAESDEGEEIDYFGGGVSKMPPLSMPASPRL
RGAATPGDIGTLTEEMQALGTSDYRGYGWPSSAEDEEDSYPFPLVMKVRSRSGSVISGAS
TPGGGAHRSLSERDLQQADQALSQVTQVNGTGATAITEVQAA
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgacgaccatgtccgcgacgaccatatccgcgacgacttcagaaaagcgcgac
gttcagaaccctctgctttttgaatgtgcctgggaggttgctaacaaggtcggcggtatc
tacaccgtcatcaagacaaaagttccagtcactgtctcggagtatggagatcgatactgc
cttataggtcctctcagctacaagacagcgccaatggaagtcgagcagcaggagcctacc
gatcctcacttggcggcaactctcgagaatatgcggtctcaaggtgtcaaggctctctat
ggccgatggctcatcgaaggtgcaccccgggttcttcttttcgatacaggcagccaatat
tcgaggctcgacgaatggaaagccgatctttggaatcttgctggcattccatcgcccccc
aacgatcacgaaacaaacgaaactattgtttttggttatctggtagcttggttcttgggc
gactatgtgtcgcgccagctcactaccgctgttgtcgcccactttcacgaatggcaagcg
ggcctcgcgatcccgctctgtaggaaaaggcatattgacgtcacaaccgtcttcaccacc
cacgccactctcctgggccggtacttgtgtgccggttccgtcgatttctacaacaatcta
cagtatttcgacgtggatcacgaagcgggcaaacgcgggatctatcacagatattgcatt
gaacggagtgcggcccattgtgccgatgttttcacgacggtttcccatatcaccgcgtac
gagtcggagcacctgttgaaaaggaagcccgacggcgttttacccaacggactcaatgtc
gtcaagttccaggccatgcacgaattccagaacatgcactcgaccagcaaagccaagatt
aacgagtttgtgcgaggccacttctacgggcactacgatttcgacctggataataccctt
tatatgtttactgcagggcgatatgagtaccgaaacaagggtgtcgatatgtttattgaa
tcgcttgctcgcctcaattaccgacttcagaaagcagggtctaccgttactgtgatcgct
ttcatcatcatgccggcaaccaccaactcttacaccatcgaggcactcaagggccaggcc
gtcacgaaacaacttcgagatacggtgacagagatccaaaaccgaattggtgcaaggcta
tttgatcatgctgcacggttccatggggacacgaaggctatcccaacaacagacgatctg
ctctcaccggaagatcaggtgcttctcaaaagacgaatcttcgccctgaagcgcaactcg
ctacctcccgtcaccactcataacatggctgacgatgccaacgatcctatccttaatcag
attagacgagtcaagcttttcaacaacaaccacgatcgagtcaaagtcgtcttccatccc
gactttttgaacgccaacaatcctatcctgggcatggattatgaggagtttgtacgtggc
tgccatttgggtgttttcccgagttactatgagccttggggttacacaccggccgagtgt
acagtgatgggtattcccagcataaccaccaacctttccggtttcggttgcttcatgcaa
gaccttatcgaacgacctcaagatgaaggctgctacatcgtcgacagacgtatgcaatcc
gttgaggactcggttaaccaactcaccgaccacatgttctcgttctgctccaagacaaga
cgtcagcgtatcaaccagcgcaaccgcgtcgaacgtcttagtcctctgttggactggaag
aatctcggaatcgaatacagcaagagtcggcaactggcattgaggagggcgtatcctgat
cagttctatggtcctgccggtgatccttatgctgagagcgatgaaggagaggagatagac
tactttggtggtggtgtgagtaagatgccgccgctaagtatgccggcgagtccacgattg
agaggcgcggctacgcccggtgatattggaacattgactgaggagatgcaagctctcgga
acaagtgactaccgaggatatggatggccttcgtctgcagaagacgaggaagactcgtac
cccttcccattggtcatgaaagtacgttcacggtcaggctctgtcattagcggtgctagc
acccccggcggtggagcccacagaagcctgagtgaacgagaccttcaacaagccgatcag
gcgctaagccaagtgacacaagtcaacggtactggcgccactgctattactgaggttcag
gccgcgtaa

DBGET integrated database retrieval system