KEGG   Moniliophthora roreri: Moror_4688Help
Entry
Moror_4688        CDS       T03137                                 

Definition
(RefSeq) isocitrate dehydrogenase
  KO
K00031  
isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mrr  Moniliophthora roreri
Pathway
Citrate cycle (TCA cycle)
Glutathione metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Peroxisome
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mrr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Moror_4688
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Moror_4688
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    Moror_4688
Enzymes [BR:mrr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Moror_4688
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 448 aa AA seqDB search
MWARQSFLGLRLRSSAVASRRHFSHSFRLESNMNKIVVQNPVVELDGDEMTRIIWKKIRE
ELILPYLQLDIKYYDLGLEYRDQTNDEVTVEAAQAIQQYGVGIKCATITPDEARVKEFNL
KQMWKSPNGTIRNLIGGTVFREPIILSRIPRPIPGWVKPIVIGRHAFGDQYRSTDFVAPG
PGKLQLVYTPKDGSPATTLDVYDFKGPGVAMSMYNTDESITGFAHSSFKMALAKKMPLFM
STKNTIMKKYDGRFKDIFQEIYEKEYQALFEQAGIYYEHRLIDDMVAQAIKSSGGFVWAT
KNYDGDVQSDILAQGFGSLGMMTSELITPDGKTLESEAAHGTVTRHYREYQKGNETSTNP
VASIFAWTRGLLHRAKLDDNAPLRKFCEELEVSCIEVIDQDGIMTKDLALAIYGKEMKRE
HWVITDVYMEKVKEKLQSKLNATLKAKL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgtgggcgaggcaatccttcctgggcctccgtctccgaagctctgcagtagcgtctaga
agacatttcagccattcttttagattagagagcaacatgaacaagattgtcgttcagaac
cccgttgttgagctagatggcgatgagatgactagaatcatctggaagaaaatcagggaa
gagcttatacttccatatctccaactggacatcaaatactatgatcttggtttggaatat
cgggatcagacgaatgatgaggtcaccgttgaagctgctcaggccattcagcaatatggt
gtcggaatcaaatgtgcgactattacaccggatgaagcccgtgtcaaggaattcaacctc
aagcaaatgtggaagagcccgaacggcaccattcgtaacttgatcggcggaaccgttttt
cgtgaacctatcattctttctcgcatcccgagacccatccccggttgggtgaaacctatt
gtcattggtagacacgcatttggtgaccagtaccggtcgaccgactttgtcgctccaggt
cctggaaaactccagcttgtttacactccaaaggatggttcccctgcaacaaccttggat
gtttacgacttcaagggacctggcgttgccatgagcatgtataacacagatgaatctatt
actggttttgcccattcttcgttcaagatggctttggctaagaagatgcctctgttcatg
tctacgaagaacaccatcatgaagaagtatgatggtcgattcaaggatattttccaggag
atctacgagaaggaataccaagccctattcgagcaagcaggcatctactatgagcaccgt
ctgattgacgatatggttgctcaagccatcaagtcttcaggagggttcgtttgggccacc
aagaattatgacggtgatgttcaaagcgacattctcgcgcaaggtttcggtagtctggga
atgatgaccagtgagctcatcacaccggacggaaagactcttgagagtgaagctgcacat
gggactgtcacccgtcactaccgcgagtaccagaaaggaaacgagacctccactaacccc
gttgcatccatctttgcctggactcggggtcttttgcaccgtgctaagctcgatgacaat
gcacctctgcgcaagttctgcgaggagcttgaggtatcttgcattgaggtcattgatcag
gatggtatcatgaccaaagacctcgctctggctatctacggaaaggagatgaagagggag
cactgggtcatcactgacgtctacatggagaaagtcaaggaaaaacttcaatcgaagctt
aacgctaccctcaaggctaagctgtga

DBGET integrated database retrieval system