KEGG   Mycobacterium sp. JS623: Mycsm_06080Help
Entry
Mycsm_06080       CDS       T02423                                 

Definition
(GenBank) DNA polymerase LigD, polymerase domain protein
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(6041208..6042260)
Genome map
AA seq 350 aa AA seqDB search
MATPAEEIDVDGVKVRLTNPDKVYFPKLGSDGTKRKLVEYYLAVASGPMLTALRDRPTHL
QRFPDGIEGEEIYQKRIPKHAPDYLETCVVTFPSGRTADALKVTHAAAIVWAAQMGTITL
HPWQVRCADTEHPDELRVDLDPQPGTAFKEARAIAVDVLKPVLDELGLVGYPKTSGGRGV
HIFLRIKPDWDFIAVRRAGIALAREVQRRAPDAVTTSWWKEERGKRIFIDYNQNARDRTF
ASAYSARKTPIATVSMPLTWDELRDADPDNYTITTAPGFVAGRDDPWEGIDSVAQSLEPL
MEMVKADEERGLGDLPYPPSYPKMPGEPPRVQPSKKVAANWDDEGNPVSR
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaccggcagaagaaatcgacgtcgacggggtcaaggtccggctgaccaatcct
gacaaggtgtatttcccgaagctgggctccgacggcaccaagcgcaagctcgtcgagtat
taccttgccgtcgcgagtggtccgatgctcacggcgctgcgcgaccggccgacacatctg
cagcgctttcccgacggcatcgagggcgaggagatctatcagaaacgaatccccaagcac
gcgccggattatctggaaacctgtgtggtgacgttcccgtcgggccgaactgcggacgcg
ctcaaggtgactcacgcggcggcgatcgtgtgggccgcgcagatgggcaccatcacgctg
cacccgtggcaggtgcgatgcgctgacaccgagcatcccgacgaacttcgcgtcgacctg
gatccgcagccgggcaccgctttcaaggaggctcgcgcaatagccgtcgacgtgctcaag
ccggtgctcgacgaactcggcctggtcggctatccgaagacatccggcggtcgcggcgtg
cacatcttccttcgcatcaagccggattgggatttcatcgcggtgcggcgggcgggtatc
gcgctggctcgagaggtccagcggcgggcacccgatgcggtcaccacctcatggtggaaa
gaagagcgtggcaagcgaatcttcatcgactacaaccagaacgcccgcgaccgcaccttc
gcgtcggcgtattcggcgcgcaagacgccgatcgcgacggtgtcgatgccgttgacgtgg
gatgagctgcgcgacgccgaccccgacaactacaccatcaccaccgcacccggtttcgtc
gccggccgcgacgacccatgggagggaatcgattcggtggcccagtcattagagccactg
atggagatggtcaaggccgacgaggagcgtgggctcggcgatctgccgtacccgccgagc
tatccgaagatgccgggcgagccgccgcgggtgcaaccgagcaaaaaggtggccgcgaat
tgggacgacgagggcaacccggtgagccggtga

DBGET integrated database retrieval system