KEGG   Mycobacterium sp. JS623: Mycsm_06082Help
Entry
Mycsm_06082       CDS       T02423                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
msa  Mycobacterium sp. JS623
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6043489..6044565
Genome map
AA seq 358 aa AA seqDB search
MQLPVMPPVSPMLAKPVRSIPPDASYEPKWDGFRTICFRDRHEVELGSRNERPMTRYFPE
VVAAITTELPQRCVVDGEIVIATDHGLDFEALQLRLHPAASRVNMLAERTPASFIAFDLL
ALGDEDYTERPFHERRAALVDALADSGPSVHVTPATTDLATAQRWFSEFEGAGLDGLIAK
PSAITYQPDKRVMFKIKHERTADCVVAGYRMHKSGDGAVGSLLLGLYRDDGTLASVGVIG
AFPMAERRQLFSELQSFVTTFEQHPWNWAAHMAADSTPRRYEGGSRWNAGKDLSFVPLRP
ERVVEVRYDHMEGERFRHTAQFNRWRPDRDPRSCTYEQLEQPVMFDLGDIVPGLGRNV
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgcccgtgatgccgcccgtgtcgccgatgctggccaagccagtgcggtcaatc
ccgccggacgcgtcctatgaaccaaaatgggacggcttcaggaccatctgcttccgcgac
cgccacgaggtggagctgggcagccgcaacgaacggccgatgacccggtatttcccggaa
gtggttgcggccatcacgaccgaactgccgcagcgctgcgtagtcgacggtgagatcgtg
atcgcgaccgaccacggcctggatttcgaggcgttgcagttgcgcctgcacccagcggcc
agccgcgtcaacatgctcgccgagcggacgcccgcctcgttcattgcgttcgatctgctg
gccctcggcgacgaggactacaccgagcgaccgttccacgagcggcgcgccgcactcgtc
gacgcattggccgattccggcccgtcggtccatgtcacgcccgccaccaccgatctggcg
accgcgcagcggtggttctccgaattcgagggcgccgggctcgacggtctgatcgccaag
ccgtctgcgatcacctatcagccggacaagcgagtcatgttcaaaatcaagcacgaacga
accgccgactgtgtggtcgccggctaccggatgcacaagtcgggggacggcgcggtcggc
tcactgctgctcggcctctaccgcgacgacggcaccctcgcctcggtcggcgtgatcggc
gcgtttccaatggccgagcggcggcagctgttcagcgagttgcagtcatttgtcaccacg
ttcgagcaacacccgtggaactgggccgctcacatggcagccgacagcacaccgcgtcga
tacgaggggggttcgcggtggaacgcgggtaaggacctgtcgttcgtgccgctgcgaccc
gaacgcgtggtggaggtgcgctacgaccacatggagggcgaacggttccgccacaccgcg
cagttcaaccgctggcgacccgaccgcgacccccgctcatgcacctacgaacagctcgag
cagccggtgatgttcgaccttggcgatatcgtgcccggcctcggccgaaacgtgtga

DBGET integrated database retrieval system