KEGG   Mycobacterium smegmatis MC2 155: LJ00_31160Help
Entry
LJ00_31160        CDS       T03433                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
msb  Mycobacterium smegmatis MC2 155
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6369432..6370496
Genome map
AA seq 354 aa AA seqDB search
MDLPVLPPVSPMLSKSVNQIPPGMSYEPKWDGFRSILFRDGAEVELGSRKERPMTRYFPE
LVAAALTELPDRCVIDGEIVLPADNHLDFEALQLRLHPAASRVAMLAEQTPAAFIAFDLL
ALGDDDYTGRPFSERRAALETALADAGPTFHLTPATTDLPTAQRWFHEFEGAGLDGVIAK
PLDLTYQPDKRVMFKVKHQRTADCVVAGYRLHKSGADAVGSLLLGLYDDDGSLASVGVIG
AFPMATRRALFTELQTLVADFDHHPWNWAAQAAADPELARRYGGGSRWNAGKDLSFVPLR
PERLVEVRYDHMEGRRFRHTAQFNRWRPDRDARSCTFAQLDSPPHSSSVTSCRV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtgctgcctccggtgtcgcccatgctgtcgaagtccgtgaaccagatc
ccgccggggatgtcgtatgaacccaagtgggacgggttccggtcgatcctgttccgcgac
ggcgccgaggtggaactcggcagccgcaaggaacggcccatgacccgctactttcctgaa
ttggtggccgcggcgctgaccgagcttcccgaccgctgcgtgatcgacggcgagatcgtc
ctaccggccgacaaccacctcgacttcgaggcgctgcaactgcgtctgcaccccgccgcg
agccgggtggcgatgctcgccgaacagacgcccgcagcgttcatcgcgttcgatctgctg
gcactcggcgacgacgactacaccggccgaccgttcagcgagcgtcgcgccgcgctcgag
accgccctcgcggatgccggcccgacgttccacctgacgcccgccaccaccgatctgccg
actgcgcagcgctggttccacgagttcgaaggcgccggtctcgacggggtcatcgccaaa
cccctggacctgacctaccagccggacaagcgcgtcatgttcaaggtcaagcaccagcgc
accgcggactgcgtggtcgccgggtaccggctgcacaaatccggcgccgacgccgtgggc
tcgctgctgctcgggttgtacgacgacgacggcagcctcgcgtcggtcggcgtcatcggc
gccttcccgatggcgacccggcgggcgctgttcaccgaactgcagacgctggtagccgat
ttcgaccatcacccgtggaactgggccgcgcaggccgcggccgatccggaactcgcccga
cgctacggcggcgggtcacgctggaatgcgggcaaggatctgtcgttcgtcccgcttcgc
cccgaacgcctggtcgaggtgcgctacgaccacatggagggccgccggttccggcacacc
gcgcagttcaaccgctggcgcccggaccgcgacgcgcgttcgtgcacattcgcacagctc
gactccccaccgcattcgagctcggtgacatcgtgccgggtttag

DBGET integrated database retrieval system