KEGG   Mycobacterium smegmatis INHR2: LI98_05015Help
Entry
LI98_05015        CDS       T03432                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
msh  Mycobacterium smegmatis INHR2
Pathway
Thiamine metabolism
Folate biosynthesis
Metabolic pathways
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:msh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LI98_05015
   00790 Folate biosynthesis
    LI98_05015
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LI98_05015
Enzymes [BR:msh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     LI98_05015
Exosome [BR:msh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LI98_05015
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:msh00537]
 Enzymes
  LI98_05015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1081475..1083010)
Genome map
AA seq 511 aa AA seqDB search
MPVSTYLRATVVIVAAALLPLTACSSDTTTESSGDTVHRSADGDIVTNGGARRIDGDQTD
TERSAINGGKARNVILLVGDGMGDSEITMARNYEKGAGGSFDGLDALPLSGQYTTYALNK
DGKPNYVTDSAASATGWTTGTKTYNGALGIDIKGNPQKTILELAKAQGFATGDVTTSEIQ
DATSASLFSHISERDCYGPVQTAADCAADALENGGPGSVTEQLLTTRPDLTLGGGAETFS
QTANGGEYKGKTLEAQAKERGFQIVRTASELDAVTAADQDNPVIGLFADGNMPVRWSGPP
AVRHGYLQPAAKCTDNPERGSEVPRLAAMTQKAIDLLKNGKAGQDKGFYLQVEGASIDKK
DHDADPCGQIGETVDFDEAVQTALNFAREDGNTLVVVTADHGHSSQIVEALSEDDLRDIA
EDTKQPVERVRDTMYPGLTRKLVTADDAEMTVSYGTSADVDVESETHTGTQVRVAAFGPR
AANVVGLTDQTDLFFTMTDALGLDRGEEPAH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgtcagtacctatctcagagcgacggtggtgatcgtggcagccgcgctgctgccg
ctcacggcctgcagcagcgacaccaccacggagtccagcggtgacacggtgcaccgctcg
gccgacggcgacatcgtgaccaacggtggcgcgcgccgtatcgacggcgaccagaccgac
accgagcgcagcgcgatcaacggcggcaaggcccgcaatgtcatcctgctggtcggcgac
ggcatgggcgactcggagatcaccatggcccgcaactacgaaaagggcgcaggcggaagc
ttcgacggcctcgacgcgctgccgctgagcgggcagtacaccacctacgcgctcaacaag
gacggtaagcccaactacgtcaccgattcggccgcgagcgccacgggatggaccaccggc
accaagacctacaacggcgcgctgggcatcgacatcaagggcaacccgcagaagacgatc
ctcgaactcgccaaggcacagggtttcgcgaccggtgacgtcaccacgtcggagatccag
gacgccacctcggcgtcgctgttctcccacatcagcgagcgtgactgctacggcccggtc
cagaccgcagccgattgcgcggccgacgccctggagaacggcgggccgggttcggtgacc
gagcagttgctgaccacccgcccggacctgacattgggcggcggcgccgagacgttctcc
cagaccgcgaacggcggcgagtacaagggcaagacgctcgaagcccaggccaaggagcgt
gggttccagatcgtgcgcaccgcaagcgaactcgacgccgtcaccgcggccgatcaggac
aatccggtgatcgggctgttcgccgacggcaacatgccggtgcgctggtcaggcccgccc
gccgtgcgccacggctacctgcagcccgcggccaagtgcaccgacaatcccgagcgcggg
tccgaggtccccaggctggccgcgatgacgcagaaggccatcgatctgttgaagaacgga
aaagccggtcaggacaagggcttctacctgcaggtggaaggcgcgtcgatcgacaagaag
gaccacgacgccgacccgtgcggccagatcggcgagacggtggacttcgacgaggccgtg
cagaccgcgctcaacttcgcccgcgaggacggcaacacgctggtcgtcgtgaccgccgac
cacggtcacagcagccagatcgtggaggccctcagcgaggacgacctgcgcgacatcgcc
gaggacaccaagcagcccgtcgagcgggtccgcgacaccatgtacccgggcctgacccgc
aagctcgtcacggccgatgacgccgagatgacggtcagctacggcacttccgccgatgtc
gacgtcgagagcgagacccacaccggaacccaggtgcgtgtcgcggccttcggtccgagg
gccgcgaacgtcgtcgggctgaccgatcagaccgatctgttcttcaccatgaccgatgcg
ctcggcctcgaccgcggggaggaacccgcgcactga

DBGET integrated database retrieval system