KEGG   Mycobacterium smegmatis INHR2: LI98_08675Help
Entry
LI98_08675        CDS       T03432                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
msh  Mycobacterium smegmatis INHR2
Pathway
msh00564  Glycerophospholipid metabolism
msh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msh00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    LI98_08675
Enzymes [BR:msh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LI98_08675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 FAD_binding_3 Pyr_redox_2 GIDA AlaDh_PNT_C 3HCDH_N NAD_binding_8 HI0933_like Thi4 Pyr_redox Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AIU20211
LinkDB All DBs
Position
1829116..1830861
Genome map
AA seq 581 aa AA seqDB search
MTVPKPAPGDGQTFLGPQQRAQAWEQLGNQQFDVVVIGGGVVGAGAALDAATRGLKVALV
EARDFASGTSSRSSKMFHGGLRYLEQLEFGLVREALHERELSLTTLAPHLVKPLPFLFPL
TNRWWERPYVAAGIFLYDQLGGAKSVPAQKHLTKAGALRLAPGLKRSSLIGGIRYYDTVV
DDARHTMTVARTAAHYGAVVRSSTQVVALLREGDRVTGVRVRDSEDGSVTEVNGHVVVNA
TGVWTDEIQALSKQRGRFRVRASKGVHIVVPRDRIVSEVAIILRTEKSVLFVIPWGTHWI
IGTTDTDWNLDLAHPAATKADIDYILGHVNTVLATPLTHDDIDGVYAGLRPLLAGESEET
SKLSREHAVAVPAPGLVAIAGGKYTTYRVMAADAIDAAAEFVPTRVAPSITEKVPLMGAD
GYFALINQTEHVGRQYGLHPYRVRHLLDRYGSLIGEVLALADGKPELLEPITEAPVYLKV
EAAYAAAAESALHLEDILARRMRISIEYPHRGVECAREVAEVVAPILGWSVEDVDREVAT
YAARVDAEVRSQQQPDDESADALRQAAPEARAEILEPVPLN
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtcccgaaaccggctccgggcgacgggcaaaccttcctggggccacagcaacgg
gcgcaagcctgggagcaactcggcaatcaacaatttgacgtcgtcgtcatcggaggcggt
gtggtcggcgcgggcgccgccctggatgccgcgacgcgcggcttgaaggtcgcgctggtc
gaggcgcgtgatttcgcctccggtacctccagtcgcagcagcaagatgttccacggcggc
ctgcgctatctcgaacagctggagttcgggctggtccgtgaggcgctgcacgaacgtgaa
ctgtcgctgacgacgctggccccacatctggtgaagcccttgcctttcctgttcccgctc
accaacaggtggtgggagcggccctacgtggcggcgggcatcttcctctacgaccagctc
ggcggcgcgaaatcggttccggcgcagaagcatctgaccaaggccggtgcgctgcgcctg
gcgcccggtctcaaacgcagctcgctgatcggcggaatccgttactacgacaccgttgtc
gacgacgccaggcacaccatgaccgtcgcgcgcaccgcggcccactacggcgcggtggtg
cgcagttcgacgcaggtggtcgcgctgctgcgcgagggcgaccgggtgaccggcgtgcgg
gtgcgtgactccgaggacggctcggtcaccgaggtcaacggccatgtcgtggtcaacgcg
acgggcgtgtggaccgacgagatccaggcattgtccaaacagcgtggccgtttccgggtg
cgggcctccaagggcgtgcacatcgtggtgccgcgcgaccgcatcgtcagcgaggtcgcg
atcatcctgcgcaccgagaagtcggtgctgttcgtgatcccgtgggggacgcactggatc
atcggcaccaccgacaccgactggaatctcgatctcgcgcacccggccgcgacgaaggcc
gacatcgactacatcctgggccacgtcaacaccgtgctggcgacaccgctgacccacgac
gacatcgacggcgtctacgcgggactgcggccactgctggccggtgaaagcgaggaaacc
tccaaactgtcacgcgaacacgccgtcgcggtgcccgcgcccggcctggtcgcgatcgcg
ggcgggaaatacaccacctaccgcgtgatggccgccgacgcgatcgacgcggccgcggag
ttcgtgccgacgcgcgtggcaccgtcgatcaccgagaaggttccgctgatgggcgccgac
gggtacttcgcgctgatcaaccagaccgagcatgtgggacggcagtacggcctgcacccg
taccgggtgcggcacctgctggaccgttacggctcgctgatcggcgaggtgctcgcgctc
gccgacggcaaacccgaactgctcgagccgatcaccgaggcgccggtgtacctcaaggtc
gaggcggcctatgccgcggcggccgagtcggcgctgcacctcgaggacatcctggcccgg
cgcatgcgcatctcgatcgagtacccgcaccgcggcgtcgagtgcgcgcgcgaggttgcc
gaagtggttgccccgatcctgggttggagcgtcgaggacgtcgaccgcgaggtcgccacc
tacgccgcccgggtggacgccgaggtgcgctcgcagcagcaacccgacgacgaatccgcc
gacgcgctgcggcaggccgcgcccgaggcccgcgccgagatcctcgaaccggtaccgctc
aattga

DBGET integrated database retrieval system