KEGG   Mycobacterium smegmatis INHR2: LI98_15415Help
Entry
LI98_15415        CDS       T03432                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
msh  Mycobacterium smegmatis INHR2
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LI98_15415
  Energy metabolism
   00680 Methane metabolism
    LI98_15415
Enzymes [BR:msh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LI98_15415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
3170012..3172813
Genome map
AA seq 933 aa AA seqDB search
MADSNDTALEPFGSVQRTHIGREASEPMREDIRLLGAILGDTVREQNGEEVFDLVERARV
ESFRVRRSEIDRSELADMFSGVDAHQAIPVIRAFTHFALLANVAEDIHRERRRAVHVAAG
KPPQDSSLAATYRKLDAADLDVDKVADTLTGALVSPVITAHPTETRRRTVFDTQHRITEL
MRLRLHGHTRTDDNRDIETELRRHILTLWQTALIRLSRLKISDEIETGLRYYEAAFFDVI
PQVNAEVRDALRKRWPDAKLLEEPILRPGSWIGGDRDGNPNVTPEVVRHATGRAAYVALA
HYFEQITALEQELSMSARLVKVTPALAALADACHEPARADEPYRRALRVIHARLTSTARE
ILDEQPEHGLDLGLPRYQTPAEFLADLDAVDGSLRANGSRVLADDRLGRLREAVRVFGFH
LSGLDMRQNSDVHEEVVAELLAWAGVHPDYTSLSEPQRVELLAAEIATRRPLIREGAELS
ELAQKELGIVAAAARAVKVFGPQAVPNYIISMCQSVSDMLEAAVLLKEAGLLDISGSTPY
APVGVVPLFETIDDLQRGSSILEAALDLPEYRTMVDARDGHQEVMLGYSDSNKDGGYLAA
NWALYRAELDLVESARKTGIRLRLFHGRGGTVGRGGGPSYDAILAQPPGAVKGSLRITEQ
GEVIAAKYAEPRIAHRNLETLLAATLEASLLDVEGLGEEAEPAYQVLDELAALAQRAYSE
LVHETPGFVEYFKTSTPVSEIGALNIGSRPTSRKPTTSIADLRAIPWVLAWSQSRVMLPG
WYGTGSAFENWIGTDPDGARLRVLQDLYARWPFFRTVLSNMAQVLAKADMGLAARYSELV
EDADLRARVFDKIVAEHDRTIRMHRLITGQDDLLADNAALARSVFNRFPYLEPLNHLQVE
LLRRYRSGETDELVQRGILLTMSGLATALRNSG
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atggccgactcgaatgacaccgcactcgaaccgttcggatcggtccaacggacccacatc
ggccgggaggcctccgagccgatgcgtgaggacatccgcctgctcggcgcgatcctgggt
gacaccgtgcgtgagcagaacggcgaagaggtgttcgacctggtcgagcgggcccgggtg
gagtcgttccgggtgcgccgctcggagatcgaccggtccgagttggcagacatgttcagc
ggtgtcgacgcgcaccaggcgatcccggtgatccgggcgttcacgcatttcgcgttgctg
gccaacgtcgcagaggacatccaccgtgagcgccgccgggccgtgcacgtggcggccggg
aaaccgccccaggacagcagccttgctgcgacgtaccgcaagctcgacgccgccgacctc
gacgtcgacaaggtggccgacacgctgacaggtgcgttggtgtcacccgtgatcaccgcg
cacccgaccgagacacgaaggcgcacggtgttcgacacgcaacaccgcatcaccgagctg
atgcgcctgcgcctgcacgggcacacgcgcaccgacgacaaccgcgacatcgagaccgaa
ctgcgccgccacatcctgaccctgtggcagacagcgttgatccggctgtcgcgcctgaag
atctccgacgagatcgagacgggcctgcgctattacgaggccgcgttcttcgacgtcatc
ccgcaggtcaacgccgaggtgcgcgatgcgctgcgcaagcggtggcccgacgcgaagctg
ctcgaagagccgatcctgcgtcccggctcgtggatcggcggcgaccgtgacggaaacccc
aatgtcacaccggaagtggtgcggcatgcgaccggccgtgcggcctacgtcgcgctggcg
cactacttcgaacagatcaccgcgctcgagcaggaactgtcgatgtccgcgcgcctggtg
aaggtgacgccggcgctcgccgcgctcgccgacgcctgccacgaaccggcccgcgccgac
gaaccgtaccggcgcgcgctgcgggtgatccacgcgcgcctcacctcgaccgcgcgtgag
atcctcgacgagcaacccgagcacggcctcgacctgggcctgccgcggtaccagacgccc
gcggagttcctcgccgacctcgacgccgtcgacgggtcgctgcgtgccaacggcagccgc
gtgctggccgacgaccggctcgggcggttgcgagaagccgtgcgggtcttcggattccac
ttgtccgggctcgacatgcgacagaactccgacgtgcacgaggaagtggtcgccgagctg
ctggcgtgggccggggtgcatcccgactacacgtcgctgtccgaaccgcagcgcgtcgag
ctgctggccgccgagatcgccacacgtcgcccactgatccgcgagggtgccgaactgtcc
gaactggcgcagaaggaactcggcatcgtcgcggccgcggcccgcgcggtcaaggtgttc
ggcccgcaggcggtgcccaactacatcatctcgatgtgccagtcggtctccgacatgctc
gaggccgccgtgctgctcaaagaggccgggctgctggacatctcgggatcgacaccctac
gccccggtgggtgtcgtcccgctgttcgagaccatcgacgacctgcagcgcggctcgtcg
atcctggaggcggcgcttgacctgccggagtaccgcacgatggtcgatgcccgcgacggt
caccaggaggtcatgctcgggtactccgattccaacaaggacggcggctatctcgcggcg
aactgggcgctgtaccgcgccgaactcgacctcgtggaatcggcccgcaagaccggaatc
cggttgcggctcttccacggacgcggcggcaccgtgggtcgcggcggcggccccagctac
gacgccatcctggcgcagccaccgggcgcggtgaagggctcgctgcggatcaccgagcag
ggcgaggtgatcgcggccaagtacgccgagccgcggatcgcgcaccgcaaccttgagacg
ctgctggcggcgacgctggaagccagcctgctcgacgtggagggcctgggggaggaggcc
gaaccggcctaccaggtcctcgacgaactggccgcgctggcacaacgggcgtactccgaa
ttggtgcacgagacaccgggtttcgtcgaatatttcaagacctcgacgccggtcagcgag
atcggtgcgctcaacatcggcagccgtcccacctcacgcaagccgacgacgtccatcgcg
gacctgcgcgcgatcccgtgggtgctggcgtggagccagtcgcgggtcatgctgcccggc
tggtacgggacgggctcggcgttcgagaactggatcggcaccgacccggacggtgctcgc
ctgcgggtgctgcaggacctgtacgcgcggtggccgttcttccgcacggtgctgtcgaac
atggcgcaggtgctggccaaggcggacatggggctggcggcgcgctactccgaactggtc
gaggacgccgacctgcgtgcgcgtgtgttcgacaagatcgtcgccgaacacgaccgcacg
atccgcatgcaccggttgatcacggggcaggacgatctgctggccgacaacgcggcgctg
gcacgttcggtgttcaaccggttcccgtacctggagccgctgaaccacctgcaggtcgaa
ctgttgcggcgctaccgctccggtgagaccgacgagttggtgcagcggggcatcctgctc
accatgagcgggctggccactgcgctgcgcaacagcggatag

DBGET integrated database retrieval system