KEGG   Mycobacterium smegmatis MC2 155: MSMEG_1736Help
Entry
MSMEG_1736        CDS       T00434                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Glycerophospholipid metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MSMEG_1736
Enzymes [BR:msm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MSMEG_1736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1829060..1830805
Genome map
AA seq 581 aa AA seqDB search
MTVPKPAPGDGQTFLGPQQRAQAWEQLGNQQFDVVVIGGGVVGAGAALDAATRGLKVALV
EARDFASGTSSRSSKMFHGGLRYLEQLEFGLVREALHERELSLTTLAPHLVKPLPFLFPL
TNRWWERPYVAAGIFLYDQLGGAKSVPAQKHLTKAGALRLAPGLKRSSLIGGIRYYDTVV
DDARHTMTVARTAAHYGAVVRSSTQVVALLREGDRVTGVRVRDSEDGSVTEVNGHVVVNA
TGVWTDEIQALSKQRGRFRVRASKGVHIVVPRDRIVSEVAIILRTEKSVLFVIPWGTHWI
IGTTDTDWNLDLAHPAATKADIDYILGHVNTVLATPLTHDDIDGVYAGLRPLLAGESEET
SKLSREHAVAVPAPGLVAIAGGKYTTYRVMAADAIDAAAEFVPTRVAPSITEKVPLMGAD
GYFALINQTEHVGRQYGLHPYRVRHLLDRYGSLIGEVLALADGKPELLEPITEAPVYLKV
EAAYAAAAESALHLEDILARRMRISIEYPHRGVECAREVAEVVAPILGWSVEDVDREVAT
YAARVDAEVRSQQQPDDESADALRQAAPEARAEILEPVPLN
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
gtgactgtcccgaaaccggctccgggcgacgggcaaaccttcctggggccacagcaacgg
gcgcaagcctgggagcaactcggcaatcaacaatttgacgtcgtcgtcatcggaggcggt
gtggtcggcgcgggcgccgccctggatgccgcgacgcgcggcttgaaggtcgcgctggtc
gaggcgcgtgatttcgcctccggtacctccagtcgcagcagcaagatgttccacggcggc
ctgcgctatctcgaacagctggagttcgggctggtccgtgaggcgctgcacgaacgtgaa
ctgtcgctgacgacgctggccccacatctggtgaagcccttgcctttcctgttcccgctc
accaacaggtggtgggagcggccctacgtggcggcgggcatcttcctctacgaccagctc
ggcggcgcgaaatcggttccggcgcagaagcatctgaccaaggccggtgcgctgcgcctg
gcgcccggtctcaaacgcagctcgctgatcggcggaatccgttactacgacaccgttgtc
gacgacgccaggcacaccatgaccgtcgcgcgcaccgcggcccactacggcgcggtggtg
cgcagttcgacgcaggtggtcgcgctgctgcgcgagggcgaccgggtgaccggcgtgcgg
gtgcgtgactccgaggacggctcggtcaccgaggtcaacggccatgtcgtggtcaacgcg
acgggcgtgtggaccgacgagatccaggcattgtccaaacagcgtggccgtttccgggtg
cgggcctccaagggcgtgcacatcgtggtgccgcgcgaccgcatcgtcagcgaggtcgcg
atcatcctgcgcaccgagaagtcggtgctgttcgtgatcccgtgggggacgcactggatc
atcggcaccaccgacaccgactggaatctcgatctcgcgcacccggccgcgacgaaggcc
gacatcgactacatcctgggccacgtcaacaccgtgctggcgacaccgctgacccacgac
gacatcgacggcgtctacgcgggactgcggccactgctggccggtgaaagcgaggaaacc
tccaaactgtcacgcgaacacgccgtcgcggtgcccgcgcccggcctggtcgcgatcgcg
ggcgggaaatacaccacctaccgcgtgatggccgccgacgcgatcgacgcggccgcggag
ttcgtgccgacgcgcgtggcaccgtcgatcaccgagaaggttccgctgatgggcgccgac
gggtacttcgcgctgatcaaccagaccgagcatgtgggacggcagtacggcctgcacccg
taccgggtgcggcacctgctggaccgttacggctcgctgatcggcgaggtgctcgcgctc
gccgacggcaaacccgaactgctcgagccgatcaccgaggcgccggtgtacctcaaggtc
gaggcggcctatgccgcggcggccgagtcggcgctgcacctcgaggacatcctggcccgg
cgcatgcgcatctcgatcgagtacccgcaccgcggcgtcgagtgcgcgcgcgaggttgcc
gaagtggttgccccgatcctgggttggagcgtcgaggacgtcgaccgcgaggtcgccacc
tacgccgcccgggtggacgccgaggtgcgctcgcagcagcaacccgacgacgaatccgcc
gacgcgctgcggcaggccgcgcccgaggcccgcgccgagatcctcgaaccggtaccgctc
aattga

DBGET integrated database retrieval system