KEGG   Mycobacterium smegmatis MC2 155: MSMEG_6515Help
Entry
MSMEG_6515        CDS       T00434                                 

Gene name
treS
Definition
(RefSeq) trehalose synthase
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MSMEG_6515 (treS)
Enzymes [BR:msm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MSMEG_6515 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     MSMEG_6515 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(6578012..6579793)
Genome map
AA seq 593 aa AA seqDB search
MEEHTQGSHVEAGIVEHPNAEDFGHARTLPTDTNWFKHAVFYEVLVRAFYDSNADGIGDL
RGLTEKLDYIKWLGVDCLWLPPFYDSPLRDGGYDIRDFYKVLPEFGTVDDFVTLLDAAHR
RGIRIITDLVMNHTSDQHEWFQESRHNPDGPYGDFYVWSDTSDRYPDARIIFVDTEESNW
TFDPVRRQFYWHRFFSHQPDLNYDNPAVQEAMLDVLRFWLDLGIDGFRLDAVPYLFEREG
TNCENLPETHAFLKRCRKAIDDEYPGRVLLAEANQWPADVVAYFGDPDTGGDECHMAFHF
PLMPRIFMAVRRESRFPISEILAQTPPIPDTAQWGIFLRNHDELTLEMVTDEERDYMYAE
YAKDPRMKANVGIRRRLAPLLENDRNQIELFTALLLSLPGSPVLYYGDEIGMGDIIWLGD
RDSVRTPMQWTPDRNAGFSKATPGRLYLPPNQDAVYGYHSVNVEAQLDSSSSLLNWTRNM
LAVRSRHDAFAVGTFRELGGSNPSVLAYIREVTRQQGDGGAKTDAVLCVNNLSRFPQPIE
LNLQQWAGYIPVEMTGYVEFPSIGQLPYLLTLPGHGFYWFQLREPDPEPGAQQ
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atggaggagcacacgcagggcagccatgtcgaggcggggatcgtcgagcatccgaacgcc
gaggacttcggtcatgcgcgcacgcttcccaccgacaccaactggttcaagcacgcggtg
ttctatgaggtgctggtgcgggcgttctacgactcgaacgccgacggtatcggtgatctg
cgcggcctcaccgaaaaactcgactacatcaagtggctcggggtcgactgcctgtggctg
ccgccgttctacgattcgccgctgcgcgacggcggttacgacatccgcgacttctacaag
gtgctgcccgagttcggcacggtcgacgacttcgtcaccctgctggacgcggcccaccgc
aggggcatccgcatcatcaccgacctggtgatgaaccacacctccgatcagcacgagtgg
ttccaggaatcccggcacaatcccgacggcccctacggcgacttctacgtctggagcgac
accagcgacaggtatcccgacgcgcgcatcatcttcgtcgacaccgaggagtcgaactgg
acgttcgaccccgtccgcaggcagttctactggcaccgcttcttcagccaccagcccgac
ctcaactacgacaacccggctgtgcaggaggcgatgctcgacgtgctgaggttctggctg
gacctcggtatcgacggtttccgtctggacgcggtgccgtacctgttcgagcgcgagggc
accaactgcgagaacctgcccgagacccacgcgttcctcaagcggtgccgcaaggcgatc
gacgacgagtacccggggcgcgtgctgctggccgaggccaatcagtggcccgccgacgtc
gtcgcgtacttcggcgacccggacaccggcggcgacgaatgccacatggcgttccacttc
ccgctgatgccacggatcttcatggccgtgcggcgcgagtcccgcttcccgatctcggag
atcctggcgcagaccccgccgatccccgacaccgcgcagtggggcatcttcctgcgcaac
cacgacgagctcacgctcgagatggtcaccgacgaagaacgtgactacatgtacgccgag
tacgccaaggacccgcggatgaaggccaacgtcggcatccggcgcaggctcgcaccgctg
ttggagaacgaccgcaaccagatcgagttgttcaccgcgctgctgctctcgctgccgggg
tcgccggtgctgtactacggtgacgagataggtatgggggacatcatctggctcggcgac
cgcgacagcgtgcgtacgcccatgcagtggacccccgaccgcaatgcgggcttctccaag
gcgactccgggccggctctacctgccgcccaaccaggacgcggtgtacggctaccactct
gtgaacgtcgaggcgcaactcgacagctccagctcgctgttgaactggacgcgcaacatg
ctggccgtgcgcagccgccacgatgccttcgcagtcggcacgttccgcgaactgggcggc
tccaatccgtcggtgctggcgtacatccgggaggtcacgcgccaacagggcgacggcggc
gcgaagaccgatgccgtcctgtgtgtcaacaacctgtcccgcttcccccagcccatcgag
ttgaatctccagcagtgggccggttacatacccgtcgagatgaccggctacgtcgagttc
ccgagtatcggccagttgccgtacctgctcaccctgcccggtcacgggttctactggttc
cagcttcgagaacccgatccagaaccgggagcgcagcaatga

DBGET integrated database retrieval system