KEGG   Mycobacterium smegmatis INHR1: LI99_31165Help
Entry
LI99_31165        CDS       T03409                                 

Gene name
ligC
Definition
(GenBank) ATP-dependent DNA ligase
Organism
msn  Mycobacterium smegmatis INHR1
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6369503..6370567
Genome map
AA seq 354 aa AA seqDB search
MDLPVLPPVSPMLSKSVNQIPPGMSYEPKWDGFRSILFRDGAEVELGSRKERPMTRYFPE
LVAAALTELPDRCVIDGEIVLPADNHLDFEALQLRLHPAASRVAMLAEQTPAAFIAFDLL
ALGDDDYTGRPFSERRAALETALADAGPTFHLTPATTDLPTAQRWFHEFEGAGLDGVIAK
PLDLTYQPDKRVMFKVKHQRTADCVVAGYRLHKSGADAVGSLLLGLYDDDGSLASVGVIG
AFPMATRRALFTELQTLVADFDHHPWNWAAQAAADPELARRYGGGSRWNAGKDLSFVPLR
PERLVEVRYDHMEGRRFRHTAQFNRWRPDRDARSCTFAQLDSPPHSSSVTSCRV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacctgcccgtgctgcctccggtgtcgcccatgctgtcgaagtccgtgaaccagatc
ccgccggggatgtcgtatgaacccaagtgggacgggttccggtcgatcctgttccgcgac
ggcgccgaggtggaactcggcagccgcaaggaacggcccatgacccgctactttcctgaa
ttggtggccgcggcgctgaccgagcttcccgaccgctgcgtgatcgacggcgagatcgtc
ctaccggccgacaaccacctcgacttcgaggcgctgcaactgcgtctgcaccccgccgcg
agccgggtggcgatgctcgccgaacagacgcccgcagcgttcatcgcgttcgatctgctg
gcactcggcgacgacgactacaccggccgaccgttcagcgagcgtcgcgccgcgctcgag
accgccctcgcggatgccggcccgacgttccacctgacgcccgccaccaccgatctgccg
actgcgcagcgctggttccacgagttcgaaggcgccggtctcgacggggtcatcgccaaa
cccctggacctgacctaccagccggacaagcgcgtcatgttcaaggtcaagcaccagcgc
accgcggactgcgtggtcgccgggtaccggctgcacaaatccggcgccgacgccgtgggc
tcgctgctgctcgggttgtacgacgacgacggcagcctcgcgtcggtcggcgtcatcggc
gccttcccgatggcgacccggcgggcgctgttcaccgaactgcagacgctggtagccgat
ttcgaccatcacccgtggaactgggccgcgcaggccgcggccgatccggaactcgcccga
cgctacggcggcgggtcacgctggaatgcgggcaaggatctgtcgttcgtcccgcttcgc
cccgaacgcctggtcgaggtgcgctacgaccacatggagggccgccggttccggcacacc
gcgcagttcaaccgctggcgcccggaccgcgacgcgcgttcgtgcacattcgcacagctc
gactccccaccgcattcgagctcggtgacatcgtgccgggtttag

DBGET integrated database retrieval system