KEGG   Moorella thermoacetica: Moth_2167Help
Entry
Moth_2167         CDS       T00308                                 

Definition
(RefSeq) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mta  Moorella thermoacetica
Pathway
mta00473  D-Alanine metabolism
mta01100  Metabolic pathways
mta01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mta00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Moth_2167
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Moth_2167
Enzymes [BR:mta01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Moth_2167
Peptidoglycan biosynthesis and degradation proteins [BR:mta01011]
 Precursor biosynthesis
  Racemase
   Moth_2167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-GeneID: 3833016
NCBI-ProteinID: YP_430999
UniProt: Q2RGI3
LinkDB All DBs
Position
complement(2267151..2268272)
Genome map
AA seq 373 aa AA seqDB search
MSRPVWAEIDLEAVARNVRAIKKILAPQTEIMAIVKANAYGHGAGPVARTALANGVSWLG
VATLGEALDLRREGITAPLLILGYTPPEDAGRVVEADISQTVFSVDQARALNAAAAAVGT
RARLHLKIDTGMGRLGFLPREAVTAARAIADLPHVTLEGIFTHFAASDAADKTYTQRQLG
LFQQVIAELEKQGITFPWRHAANSGAIIDLPGTHFNLVRAGIILYGHYPSPEVQRKRLAL
TPVMTLKTRVVLVKEVPAGSYISYGCTYRTPGPARIATLPVGYADGYSRLLSNRAEVLVR
GRRAPIVGRICMDQCMIDVTAIPEVRVGDEVVLFGRQGGQTLTVEEVAAWMGTINYEILC
LISKRVPRVYLHS
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
ttgtcgcggccggtttgggccgagattgacctggaagcagtggcccgcaatgtccgggcc
attaaaaagatactggcgccgcaaacagaaattatggccatcgttaaagccaatgcctac
ggccacggggccgggccggtggccaggacagccctggctaacggcgtcagctggctgggt
gtagctaccctgggtgaagccctggacctgcggcgggaaggaattactgccccgcttctt
attttgggctataccccgccggaggatgccgggcgggtggtagaggccgatatttcccag
acggtcttcagcgttgaccaggcccgggccctgaacgccgccgccgccgctgtaggtacc
agggcccgcctgcatttaaagatcgataccggtatgggccggctgggttttctgccccgg
gaggcggtgactgcggcccgggctatagcggatctgccccatgtcaccctggaaggtatt
ttcacccactttgccgcgtccgatgccgctgataagacctacacccagcggcagctgggc
ttatttcaacaagtgattgccgaactggagaaacagggcataacctttccctggcgccat
gcagccaacagcggggccatcatcgatctccccgggacccactttaacctggtccgcgcc
gggattatcctttatggccactatccctcgccggaggtccagcggaagaggctggcgtta
acgccggtgatgacgctaaaaaccagggtagtcctggtaaaggaggtgccggccgggtcg
tatatcagctatggctgcacctaccgcacccccggtccggccaggattgccaccctcccg
gtgggttatgccgacggctattcccgtctcctttccaaccgggccgaggtcctggtccgc
ggtcgccgggcaccgatcgtcggccgtatctgtatggaccagtgcatgatagatgttaca
gctataccggaagtccgggttggtgatgaagtagtcctcttcggtcgccagggaggacag
actctgacggtagaagaggtggcggcctggatggggaccattaactacgaaatcctgtgc
ctgatatccaagcgcgtgccacgtgtatatcttcatagttaa

DBGET integrated database retrieval system