KEGG   Mycobacterium tuberculosis UT205: UDA_3730cHelp
Entry
UDA_3730c         CDS       T02142                                 

Definition
(GenBank) unnamed protein product
Organism
mtd  Mycobacterium tuberculosis UT205
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4187132..4188172)
Genome map
AA seq 346 aa AA seqDB search
MAAAAEELDVDGIAVRLTSPDRMYFPKLGSHGTKRRLVEYYFAVAGGPMLTALRDRPTHL
QRFPDGVDGEQIYQKRIPRHRPDYLQTCRVTFPSGRMADALKVTHPAAIVWAAQMGTITL
HPWQVRCPDTEHPDELRIDLDPQPGTGFVEARTVAVDVLRSVLDDLGLVGYPKTSGGRGI
HVFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTSWWKEERGARIFIDFNQNARDRTM
ASAYSVRPTPIATVSMPLTWEELAGADPDDYTMTTVPELVKIRDDPWAGMDDVAQSIAPL
LDLAAADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTDLKGGNTSK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagctgaggaactcgacgtcgacggcatcgcggtgcggttgactagcccg
gacaggatgtatttcccgaagctggggtcgcacggcaccaagcgccgcctcgttgagtac
tacttcgccgtggccgggggtccgatgctgacggcgctgcgtgaccggccgacgcacttg
cagcgcttcccggacggcgtcgacggcgagcagatctaccaaaagcggatcccgcggcac
cgccctgactacctgcagacgtgccgggtgacgtttccgtcggggcggatggctgacgcg
ctgaaggtgacccacccggcggcgatcgtatgggcggcgcagatgggcacaatcaccctg
cacccgtggcaagtgcgctgccccgacaccgagcaccccgacgaattgcgcatcgatcta
gatccgcaaccgggcaccggcttcgtggaggcgcgtacggtcgccgtcgatgtgctccgg
tccgtgctggacgacctcggtctggtcggttatccgaagacatccgggggtagagggatt
cacgtattcctgcgcatcgccaccgactgggacttcgtcgaggtgcgtcgggcgggcatt
gcgttggcccgggaagtcgagcgccgcgcaccggatgcggtgacgacgtcgtggtggaag
gaagaacggggcgcgcgtatcttcatcgacttcaaccaaaacgcccgcgaccgcaccatg
gcgtcggcctattcggtgcgtcctaccccgatcgcgacggtatcgatgccgttgacctgg
gaagagctggccggcgcggatcccgacgactacaccatgaccacggtgcccgagctggtg
aagatccgcgacgacccctgggccggcatggacgacgtggcccagtcgattgcaccattg
ctggacttggccgccgccgacgaggagcgcgggctcggtgacatgccgtatccgccgaac
tatccgaagatgccgggcgaacccaagcgggtgcagccgagccgggataccgacttgaag
gggggaaacacgtcgaagtaa

DBGET integrated database retrieval system