KEGG   Mycobacterium tuberculosis RGTB327: MRGA327_00825Help
Entry
MRGA327_00825     CDS       T01775                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  
maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mtg  Mycobacterium tuberculosis RGTB327
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MRGA327_00825
Enzymes [BR:mtg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     MRGA327_00825
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     MRGA327_00825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
152416..154224
Genome map
AA seq 602 aa AA seqDB search
MNEAEHSVEHPPVQGSHVEGGVVEHPDAKDFGSAAALPADPTWFKHAVFYEVLVRAFFDA
SADGSGDLRGLIDRLDYLQWLGIDCIWLPPFYDSPLRDGGYDIRDFYKVLPEFGTVDDFV
ALVDAAHRRGIRIITDLVMNHTSESHPWFQESRRDPDGASAGDYYVWSDTSERYTDARII
FVDTEESNWSFDPVRRQFYWHRFFSHQPDLNYDNPAVQEAMIDVIRFWLGLGIDGFRLDA
VPYLFEREGTNCENLPETHAFLKRVRKVVDDEFPGRVLLAEANQWPGDVVEYFGDPNTGG
DECHMAFHFPLMPRIFMAVRRESRFPISEIIAQTPPIPDMAQWGIFLRNHDELTLEMVTD
EERDYMYAEYAKDPRMKANVGIRRRLAPLLDNDRNQIELFTALLLSLPGSPVLYYGDEIG
MGDVIWLGDRDGVRIPMQWTPDRNAGFSTANPGRLYLPPSQDPVYGYQAVNVEAQRDTST
SLLNFTRTMLAVRRRHPAFAVGAFQELGGSNPSVLAYVRQVAGDDGDTVLCVNNLSRFPQ
PIELDLQQWTNYTPVELTGHVEFPRIGQVPYLLTLPGHGFYWFQLTTHEVGAPPTCGGER
RL
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggcagaacacagcgtcgagcaccctcccgtgcagggcagtcacgtcgaaggc
ggtgtggtcgagcatccggatgccaaggacttcggcagcgccgccgccctgcccgccgat
ccgacctggtttaagcacgccgtcttctacgaggtgctggtccgggcgttcttcgacgcc
agcgcggacggttccggcgatctgcgtggactcatcgatcgcctcgactacctgcagtgg
cttggcatcgactgcatctggttgccgccgttctacgactcgccgctgcgcgacggcggt
tacgacattcgcgacttctacaaggtgctgcccgaattcggcaccgtcgacgatttcgtc
gccctggtcgacgccgctcaccggcgaggtatccgcatcatcaccgacctggtgatgaat
cacacctcggagtcgcacccctggtttcaggagtcccgccgcgacccagacggagcgagc
gctggtgactattacgtgtggagcgacaccagcgagcgctacaccgacgcccggatcatc
ttcgtcgacaccgaagagtcgaactggtcattcgatcctgtccgccgacagttctactgg
caccgattcttctcccaccaaccggatctgaactacgacaaccccgccgtgcaagaggcg
atgatcgacgtcatccgcttttggctcggcttgggcatcgacgggtttcggttggacgcg
gtgccctatctctttgaacgtgagggcaccaactgcgagaacctgccggaaacacacgct
tttctcaagcgagtccgcaaggtggtggacgacgaattccccggccgggtgctgctagcc
gaagccaatcagtggccgggcgatgtcgtcgaatatttcggtgatcccaacaccggtggc
gacgagtgccacatggcctttcacttcccgctgatgccgcgcatcttcatggccgtgcgc
cgggagtcccgttttccgatctcggagatcatcgcccagaccccaccaatccctgacatg
gcgcaatgggggatatttctgcgcaaccacgacgagctgacgttagaaatggtcaccgac
gaagagcgcgactacatgtacgccgagtacgccaaggatccacggatgaaggcgaatgtc
ggaatccgtcgtcggcttgcgccgctgctcgacaacgaccgcaaccagatcgagctgttc
accgcgctgctgctgtcgctgcccggctcgccggtcctctactacggcgacgagatcggg
atgggcgacgtgatctggttgggtgatcgcgacggcgtgcgcatcccgatgcagtggaca
ccggaccgcaacgcgggtttctccaccgccaacccgggtcggctgtacctgccgcccagc
caggacccggtttacgggtatcaggccgtcaacgtcgaggcgcaacgcgacacctcgacg
tcgctgctcaacttcactcgcaccatgctggccgtgcgtcgccgacaccccgcgtttgcg
gtcggcgcattccaggaattgggcgggtccaacccgtcggtgctggcctacgtgcgtcag
gtggccggcgatgacggcgacaccgtgctctgtgtcaacaacctgtcgcgattcccgcag
cccatcgaattggacttgcagcaatggaccaactacacgccggtcgagctgaccgggcac
gtggagtttccacgcatcggccaggtgccctatctgctgacgctgccaggacacgggttc
tactggttccagttgaccacacatgaggtgggggcacctcccacttgcgggggagagcgg
cgcctatga

DBGET integrated database retrieval system