KEGG   Microbulbifer thermotolerans: A3224_10760Help
Entry
A3224_10760       CDS       T04393                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mthd  Microbulbifer thermotolerans
Brite
Enzymes [BR:mthd01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     A3224_10760
Peptidases [BR:mthd01002]
 Metallo Peptidases
  Family M2
   A3224_10760
Exosome [BR:mthd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A3224_10760
CD molecules [BR:mthd04090]
 Proteins
  A3224_10760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2576384..2578219)
Genome map
AA seq 611 aa AA seqDB search
MKKIALAIAATVALAGCQGEKADSVSGGDANKQLTAEDAKVFLQDAQSRLEAMAEEASRA
SWLAATYINGDSQFVEALASERYTAMAVELAAEAAKFNGLDLDPDTRRQLTMLKQGLVFP
APKDPALTAELAQIGSKMQGMYGAGKYCREEDGGEKCYTLTEMGRLMAESRDPELLEELW
VGWREISPPMKPLYERQVEIGNAGAQELGYDNLSVFWRSKYDMEPDAFSADMDAQWNKVK
PLYEALHCHVRAKLNEHYGDEVVPSTGKIPAHLLGNMWAQEWGNIYDLVKDEDMQAPYDL
TQLVVDSGMSEKDMVKVGENFFTSLGFKPLPQSFWETSQFTQPRDRDVVCHASAWNMDGQ
DDIRIKMCIQKTGEDFVTIHHELGHNFYQRIYKHQPFLYKEGANDGFHEAIGDTIALSIT
PKYLKQIGLMDEIPDESKDIGFLMQQALDKIAFLPFGLLVDKWRWQVFNGEVKPEDYNKA
WWKLREQYQGIQAPVERTEANFDPGAKYHIPGNTPYARYFLARIQQFQFHRALCEAAGET
GPLHRCSIYKNDAAGKKLRDMLAMGASKPWPDAMEALTGQRELDASAIIDYFQPLMAYLE
EQNKGRQCGWE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaattgccctagcgattgccgcgactgtggctctggccggatgtcaaggcgaa
aaggccgattctgtgtctggcggggatgctaacaagcaattgaccgcggaggatgccaag
gtatttctgcaggacgcacagtcgcgtctggaggcaatggcagaagaggcgagccgcgca
agctggttggcggctacctatatcaacggggactcccaatttgtcgaggcattggcctct
gagcgctacaccgctatggcggtggagttggctgcggaagctgccaagttcaacggcctg
gatctggatccagatactcgccgtcagttaaccatgctcaaacagggcttggtattcccg
gcgcccaaagatccggcactgactgcggagcttgcgcagatcggctccaagatgcagggc
atgtacggagccggaaaatattgccgcgaggaagatggcggggagaagtgttataccctg
accgaaatgggccgcctgatggccgagagccgcgaccccgagctgctcgaggagctgtgg
gtgggttggcgcgagatctctccgccgatgaagcctctgtacgagcgccaggtagagata
ggcaatgccggtgcgcaggagttgggctacgacaacctgagcgttttctggcgttccaag
tacgacatggagccggacgccttctctgccgatatggatgcccagtggaacaaggtcaag
ccgctttatgaggccttgcattgtcatgtgcgggccaaactgaacgagcattacggggat
gaggtggtgccgtccacaggaaagattccggcgcacctgctcggaaatatgtgggcccag
gagtggggcaatatctacgacttggtcaaggacgaggatatgcaggcgccctatgacctg
actcagctggtggtggattccggcatgagtgaaaaagacatggtcaaggtgggcgagaat
ttcttcacctctctcggctttaaaccgttgccgcagagtttctgggaaacctcccagttt
acccagccccgtgatcgcgatgtcgtctgccacgcaagtgcctggaatatggacggccag
gatgatatccgtatcaaaatgtgcattcagaaaactggtgaggactttgtcaccattcac
cacgaactggggcataacttctaccagcgtatctacaagcaccagcctttcctgtacaag
gaaggcgccaacgacggtttccacgaggcgattggcgataccatcgccctgtccatcacg
ccgaaatacctcaagcagattggcctgatggatgaaattccggacgagagcaaagatatc
ggtttcctgatgcagcaggcgctggacaagattgccttcctgcctttcggtcttttggtg
gacaagtggcgctggcaggtgtttaacggcgaagtaaaaccggaagattacaacaaggcc
tggtggaagctgcgcgagcagtatcagggcatacaggcgccggttgagcgcaccgaggcc
aatttcgatccgggtgccaagtaccatatccctggaaatacaccctatgcccgttatttc
ctcgcgcgtatacagcaattccagttccaccgcgcactctgtgaggccgccggcgagact
ggcccgttgcaccgttgctccatttataaaaacgatgccgccggcaaaaaactgcgggat
atgctcgccatgggggcaagtaaaccctggccggatgccatggaggcgctgaccggccag
cgcgagctggatgcctcggcgattatcgattacttccaaccgctgatggcgtatctggag
gaacagaataaagggcgtcagtgcggctgggagtaa

DBGET integrated database retrieval system