KEGG   Mycobacterium tuberculosis BT2: HKBT2_3948Help
Entry
HKBT2_3948        CDS       T03153                                 

Definition
(GenBank) hypothetical protein
Organism
mtuu  Mycobacterium tuberculosis BT2
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(4171081..4172121)
Genome map
AA seq 346 aa AA seqDB search
MAAAAEELDVDGIAVRLTSPDRMYFPKLGSHGTKRRLVEYYFAVAGGPMLTALRDRPTHL
QRFPDGVDGEQIYQKRIPRHRPDYLQTCRVTFPSGRMADALKVTHPAAIVWAAQMGTITL
HPWQVRCPDTEHPDELRIDLDPQPGTGFVEARTVAVDVLRSVLDDLGLVGYPKTSGGRGI
HVFLRIATDWDFVEVRRAGIALAREVERRAPDAVTTSWWKEERGARIFIDFNQNARDRTM
ASAYSVRPTPIATVSMPLTWEELAGADPDDYTMTTVPELVKIRDDPWAGMDDVAQSIAPL
LDLAAADEERGLGDMPYPPNYPKMPGEPKRVQPSRDTDLKGGNTSK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcagctgaggaactcgacgtcgacggcatcgcggtgcggttgactagcccg
gacaggatgtatttcccgaagctggggtcgcacggcaccaagcgccgcctcgttgagtac
tacttcgccgtggccgggggtccgatgctgacggcgctgcgtgaccggccgacgcacttg
cagcgcttcccggacggcgtcgacggcgagcagatctaccaaaagcggatcccgcggcac
cgccctgactacctgcagacgtgccgggtgacgtttccgtcggggcggatggctgacgcg
ctgaaggtgacccacccggcggcgatcgtatgggcggcgcagatgggcacaatcaccctg
cacccgtggcaagtgcgctgccccgacaccgagcaccccgacgaattgcgcatcgatcta
gatccgcaaccgggcaccggcttcgtggaggcgcgtacggtcgccgtcgatgtgctccgg
tccgtgctggacgacctcggtctggtcggttatccgaagacatccgggggtagagggatt
cacgtattcctgcgcatcgccaccgactgggacttcgtcgaggtgcgtcgggcgggcatt
gcgttggcccgggaagtcgagcgccgcgcaccggatgcggtgacgacgtcgtggtggaag
gaagaacggggcgcgcgtatcttcatcgacttcaaccaaaacgcccgcgaccgcaccatg
gcgtcggcctattcggtgcgtcctaccccgatcgcgacggtatcgatgccgttgacctgg
gaagagctggccggcgcggatcccgacgactacaccatgaccacggtgcccgagctggtg
aagatccgcgacgacccctgggccggcatggacgacgtggcgcagtcgattgcaccattg
ctggacttggccgccgccgacgaggagcgcgggctcggtgacatgccgtatccgccgaac
tatccgaagatgccgggcgaacccaagcgggtgcagccgagccgggataccgacttgaag
gggggaaacacgtcgaagtaa

DBGET integrated database retrieval system