KEGG   Mycobacterium ulcerans: MUL_1836Help
Entry
MUL_1836          CDS       T00435                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mul  Mycobacterium ulcerans
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mul00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MUL_1836
  Energy metabolism
   00680 Methane metabolism
    MUL_1836
Enzymes [BR:mul01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MUL_1836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
LinkDB All DBs
Position
2029883..2032690
Genome map
AA seq 935 aa AA seqDB search
MVEVSDTALEPIGDVHRTRIGREATEPMRADIRLLGAILGDTVREQNGDEVFELVERARV
EAFRVRHSEIDRAEMARMFEGIDIHHAIPIIRAFSHFALLANVAEDIHRERRRSIHVAAG
EPPRDSSLTATYMKLYAAQLDSATIAEALKGALVSPVITAHPTETRRRTIFETQHRITQL
MRLHAEGHTETDDGRGIEVELRRQVLRLWQTALIRLFRLQISDEIEVGLRYYPAALFEVI
SQVNAEVRDALRARWPDADLLSEPILRPGSWIGGDRDGNPNVTAEVVRLATGSAAFTALA
HYLAELTALAQELSMSARLITVTPELATLADACPAGARPDEPYRRALQVVRGRLSATAAE
ILDQQPQHTLELGLPPYATAAELRADLDTIDASLHNHGAGLLADDRLARLREAVRVFGFH
LSGLDMRQNSDVHEQVVGELLAWAGVHPDYTSLAEAERVELLAAELSTRRPLIRDGAQLS
DLARSELGVLAAAAHAVWTFGPAAVPNYIISMCWSVSDMLEAAVLLKEVGLLDASESEPY
CPVGISPLFETIEDLHNGAAILQAMLDLPLYRALVTARGGCQEVMLGYSDSNKDGGYLAA
NWAVYRAELALVETARKTGIRLRLFHGRGGTVGRGGGPSYQAILAQPPGAVSGSLRLTEQ
GEVIAAKYAEPQMARRNLESLLAATLESTLLAVEGLGDTAAPAYAVLDEVAALAQRAYAE
LVHETPGFVEYFKASTPVSEFGALNIGSRPTSRKPTASIADLRAIPWVLAWSQSRVMLPG
WYGTGSAFEQWLAAGPESEADRLQVLHDLYQRWPFFRSVLSNMAQVMAKSDLELAARYSE
LVADETLRRRVFDKIADEHHRTIAMYKRITGQDDLLADNPALARSVFNRFPYLEPLNHLQ
VELLRRYRSGEDDESVQRGILLTMNGLASALRNSG
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggtgtccgataccgcactcgagcccattggcgacgtccaccggacccggatt
ggccgcgaggctaccgaaccaatgcgagccgacatcagactgctgggcgccatcctcggg
gataccgtccgtgagcaaaacggtgacgaggtcttcgagttggtggagcgggcgcgggtg
gaggcctttcgggtgcggcactccgagatcgaccgcgccgagatggcgcgcatgttcgag
ggcatcgacatccaccacgccatcccgatcatccgtgcgttcagtcacttcgcgttgctg
gccaatgtggccgaagacatccaccgggagcgccgtcgcagcattcacgtcgccgccggt
gagccgccgcgggacagcagtctgaccgccacgtacatgaaactttacgcggcccagttg
gattcggcaaccatcgccgaagcgctgaaaggcgcactagtgtctccggtcatcaccgcc
catccgaccgagacccggcggcgcaccattttcgagacccagcaccggatcacccagttg
atgcggttgcacgcggaaggccacaccgaaaccgacgacgggcgcggcatcgaagtcgaa
ttgcgtcggcaggtcttgaggttgtggcagaccgcgctgatccggctgtttcggttacag
atctccgacgagatcgaggtcgggttgcggtactacccggcggcgctcttcgaggtgatt
tcgcaggtgaatgccgaggtgcgggatgcgttgcgagcccgctggcccgatgccgacctg
ctttccgaacccattttgcggccgggctcgtggatcggcggggaccgggacggaaacccg
aacgtcaccgccgaggtggttcggctggccaccggcagtgccgctttcaccgcgctggcg
cactacctggccgaactgacggcacttgcgcaggagctttcgatgtcggcgcgactgatc
accgtcacccccgaattggccacgctggccgatgcctgtccggcgggtgcccgccccgac
gagccgtaccggcgcgccttgcaggtcgtgcgcggccggctcagcgccaccgcggccgaa
atcctggaccagcaaccgcagcacacgctggagttgggcttgccgccatatgccaccgcg
gccgaactgcgggccgatctggacaccatcgatgcctcactgcataaccacggcgccggg
ttgttggccgacgaccggctggcccggctgcgtgaagcggtgcgggtcttcggatttcat
ctctccggcctggacatgcgacagaactccgacgtccacgagcaggtggtcggagagctg
ctcgcgtgggcgggcgtgcacccggactacacctcgctggccgaagcggagcgggtcgag
ctgttggcggccgaactgagcacccgccggccgctgatccgcgatggcgcgcagctttcc
gatttggcccgcagcgaactgggcgttctggcggccgccgcccacgccgtctggaccttt
ggtcccgccgcggtgcccaactacatcatctcgatgtgctggtcggtatcggacatgctg
gaagccgcggtcctgctcaaagaggtcggcctactggacgcttccgagtcggaaccctat
tgcccggtgggtatctcgccgctgttcgagacgatcgaggacctgcacaacggggcggcc
attctgcaagcgatgttggatcttccgctctatcgcgctttggtgacggcccggggtggt
tgccaggaggtgatgctcggctactcggactcgaacaaggacggcgggtatctggccgcc
aactgggcggtgtatcgagccgaactcgcgctggtggagacggcgcgcaagaccggaatc
cggctgcggctcttccatggccgtggcggcacggtcggccgcggtggcggacccagctac
caggccatcctggcgcagccgccgggtgcggtaagcggatcgttgcggctcaccgaacag
ggtgaagtgatcgccgccaagtacgccgaaccgcagatggcccgacgcaatctggagagc
ctgctggccgccaccctggagtcgacgctgctggccgtcgaggggttgggcgatacggcg
gcgccggcctatgcggtgctcgacgaggtggcggcattggcgcaacgtgcctacgccgaa
ttggtgcacgagacaccgggtttcgtcgagtacttcaaggcttccaccccagtcagcgaa
ttcggggcgctgaacatcggcagccggccgacctcgcgcaaacccaccgcttccatcgcc
gacctgcgggccatcccgtgggtgctggcttggagccagtcgcgggtgatgcttcccggc
tggtacggcaccggctcggcattcgagcaatggctagcggcgggtcccgaaagtgaggcc
gaccggctgcaggtgctgcacgacctgtatcagcggtggccgtttttccgcagcgtgctg
tccaacatggcgcaggtgatggccaagagcgacctggaactggcggcccgctactccgaa
ctggtggccgacgaaacgctgcggcgccgggtgttcgacaaaatcgccgacgagcaccac
cgcaccatcgccatgtacaagcgaatcaccggacaagacgacctacttgccgacaacccg
gccctggcgcgctcggtgttcaaccggttcccctacttggaaccgctcaaccaccttcaa
gtcgaactgctccgccgttaccgcagcggtgaggacgacgaatccgtgcagcgcggcatt
ctgctgacgatgaacgggctggccagcgcgctaagaaacagcggctga

DBGET integrated database retrieval system