KEGG   Mycobacterium ulcerans: MUL_4339Help
Entry
MUL_4339          CDS       T00435                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mul  Mycobacterium ulcerans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
LinkDB All DBs
Position
complement(4814427..4815467)
Genome map
AA seq 346 aa AA seqDB search
MPAAAEELDVDGIAVRVTNRDKVYFPKLGKQGTKGRLIDYYLAVGGGPMLTALRDRPTHL
QRFPDGIDGEEIYQKRVPKHHPDYLRTCQVTFPSGRTADALRVTHPAAIVWAAQMGTVTL
HPWQVRCPDTEHPDELRIDLDPQPGTGFAQARSVAVDVLKPVLDDLGLVGYPKTSGGRGI
HVFLRIASDWDFIEVRRAGIALAREVERRAPEAVTTSWWKEERGQRIFIDFNQNARDRTM
ASAYSVRATPIATVSTPLTWDELAGADPDDYTMATVADLIARRADPWAGMDDVAQSISGL
LDMAEADAERGLGDMPYPRNYPKMPGEPKRVQPSRDTDLKPKNAHD
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctgcagcagaagaacttgacgtcgacggcatcgcggtacgcgtgaccaaccgg
gacaaggtgtacttcccgaagctgggaaagcagggcaccaagggccggttgatcgactat
tacctggcggtcgggggcggtccgatgctgaccgcgttgcgggatcgtcccacccacttg
cagcgatttccggacggcatcgacggtgaggagatctatcagaaacgggtgcccaagcac
caccccgactatctgcggacgtgtcaggtgacctttccgtcgggacgcaccgccgacgcg
ctgcgggtgacccatccggccgcgatcgtctgggcggcgcagatgggaaccgtcacgctg
cacccgtggcaggtgcgctgccccgacaccgagcaccccgacgagctgcgcatcgatctg
gatccgcagcccggtaccggtttcgcgcaggcacgttcggtcgccgtcgacgtgctcaag
ccggtgctcgatgacctgggattggtcggctatccgaagacctccggcggccgcgggatc
cacgtgttcttgcgcatcgcgagcgactgggacttcatcgaggtgcgccgggccggcatc
gccctggcccgcgaagtcgagcgccgcgcccccgaggcggtcaccacgtcgtggtggaaa
gaagaacgtggccagcggatcttcatcgacttcaaccagaacgcccgcgaccgcaccatg
gcgtcggcgtactcggtgcgggccaccccgatcgccaccgtgtcgacgccgctgacctgg
gacgagctggccggcgccgacccggacgactacaccatggccacggttgccgacctgatt
gcccgccgcgcggacccctgggccggcatggacgacgtggcccagtcgatcagcgggctg
ctggatatggccgaagccgacgccgagcgcgggcttggtgacatgccctacccccggaac
tacccgaagatgccgggcgaacccaagcgggtgcagcccagccgcgacaccgacctgaaa
cccaaaaacgcccacgactaa

DBGET integrated database retrieval system