KEGG   Musa acuminata (wild Malaysian banana): 103989353Help
Entry
103989353         CDS       T03447                                 

Definition
(RefSeq) glutathione S-transferase zeta class-like
  KO
K01800  
maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
mus  Musa acuminata (wild Malaysian banana)
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mus00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    103989353
Enzymes [BR:mus01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     103989353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
6
AA seq 225 aa AA seqDB search
MASDSEAMARPANLTLYSYYWSSCAHRVRIALNLKGLEYEYKAVNLSKGDQFDPEFEKIN
PLKFVPALVDGDVVVADSLAIILYLEDKYPQHPLLPQDLKKKAINLQVASIVSSSIQPLQ
SFFTRQFFEKRISLDEKLTSSQNHVNKGFAAIEKLIKEIAGKYATGDEVQLADVFLAPQI
FAGVARFQIDMSLYPTLTRLNEAYAELPAFQAALPHRQPDAPSTS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgattccgaggcgatggcgcggccggcgaatctcactctgtactcctactat
tggagctcatgtgcgcaccgagtccgcatcgcccttaatctcaaagggttggagtacgaa
tataaggctgtgaatctttcgaaaggcgaccaattcgatccagagttcgagaagattaat
ccacttaaatttgttccggcactggtagatggtgatgtagtggttgctgactcgcttgca
ataatactgtatttagaagacaagtatcctcaacaccctttgctgcctcaagacctgaaa
aagaaagcaatcaacctccaggttgctagtattgtcagttcaagtattcaaccacttcag
agtttttttacacgacaatttttcgagaaaagaatcagtttggatgagaaactcacatcg
tcacagaatcatgtcaataaaggatttgcagcaatcgagaaactcataaaggagattgcc
ggcaaatatgctaccggagatgaggtccagctggcagatgtgtttctggcgccccagatc
tttgcaggagtagcacggttccaaattgacatgtcactttaccctactctaaccaggctg
aatgaagcatatgctgagttgcctgcttttcaagctgcccttcctcatcggcagccagat
gcgccttccacatcctaa

DBGET integrated database retrieval system