KEGG   Mycobacterium vanbaalenii: Mvan_4915Help
Entry
Mvan_4915         CDS       T00449                                 

Definition
(GenBank) ATP-dependent DNA ligase LigD ligase module / ATP-dependent DNA ligase LigD polymerase module / ATP-dependent DNA ligase LigD phosphoesterase module
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mva  Mycobacterium vanbaalenii
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mva00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Mvan_4915
Enzymes [BR:mva01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mvan_4915
DNA repair and recombination proteins [BR:mva03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Mvan_4915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(5264986..5267277)
Genome map
AA seq 763 aa AA seqDB search
MVDRYERVKLTNPDKVLYPATGDRRRAVTKAEVFDYYVNVAAAMLPHIAGRAVTRKRWPN
GVTEESFFEKQLASSAPDWLGRGTIVHKSGTTTYPVIDTVEGLAWIAQQAALEVHVPQWR
FVDGSVGPATRIVFDLDPGEGVTFRQLCEVANEVRDLLADIGLRTFPLTSGSKGLHLYVP
LDEPISSRGASVLAKRVAQQLEQAMPMQVTATMTKSLRTGKVFVDWSQNNANKTTIAPYS
LRGREHPTVAAPRTWEEISDPDLRQLTFDEVLDRLDRDGDLLAGLDPPVPVPDRLTRYRS
MRDTAKTPEPIPGDAPTTGNNDKFVIQEHHARRLHYDFRLERDGVLVSWAVPKNLPDTPS
VNHLAVHTEDHPMEYLTFAGEIPRGEYGGGEVYIWDTGTYETEKFRDNPPDGPDRGGEVI
VTLHGEKIDGRYALIQTDGKNWLAHRMKDQQRPTAADLAPMLTTHGSVQRLTKGQWAFEG
KWDGYRLLVEADHGRLALRSRNGRDVTAEYPQLQALAADLADHHVILDGEAVALDESGVP
SFREMQNRARSTRVEFWAFDILFLDGRSLLRAKYTDRRRVLEALADGGGLIVPPLIGADT
GAEALETARKRGWEGVVAKKRDSTYQPGRRSSSWIKDKLWNTQEVVIGGWRQGEGGRTSG
IGALMLGIPAGGVAGGLQFVGRVGTGFTEKELASLKETLAPLHTDESPFATELPKQDAKG
VTFVRPELVGEVRYSERTSDNRLRQPSWRGLRTDKTPDEVVWE
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
gtggtggaccgctatgagcgggtgaagctgaccaacccggacaaggtgctgtacccggcg
acgggggatcgacgtagggccgtcaccaaagcagaggttttcgactactacgtcaacgtc
gccgcggcgatgctgccccacatcgccggccgcgccgtcacccgcaagcggtggcccaac
ggcgtcaccgaggagtcgttcttcgagaagcagctggcgtcctcggcgccggactggctg
ggccgcggcaccatcgtgcacaagtccggaaccaccacctaccccgtcatcgacaccgtc
gagggactggcctggatcgcccagcaggccgcgctggaggtgcacgtccctcagtggcga
tttgtggacggttcggtcggcccggcgacacgcatcgtcttcgatctcgatccgggcgag
ggggtgaccttccgccagctctgcgaagtggccaacgaggtccgggacctgctcgccgac
atcggtctgcggacgttcccgttgaccagcggcagcaagggcctgcacctctatgtgccg
ctggacgagccgatcagttcccggggagcgtcggtgttggccaagagggtggcgcaacaa
ctcgagcaggcgatgccgatgcaggtcacggcgacgatgacgaaaagcctgcggacaggc
aaggtgttcgtggactggagccagaacaacgccaacaagacgaccatcgccccgtattcg
cttcgggggcgcgaacatccgacggtcgccgcgccgcgcacctgggaggagatctccgac
cccgacctgagacagctgacgttcgacgaggttctcgaccggctggaccgcgacggtgat
ctgctcgccgggctcgatccgccggttccggtgccggaccggctcacccggtaccgcagc
atgcgcgacaccgccaagacgcctgagccgattccgggcgacgcgccgacgaccgggaac
aacgacaagttcgtcatccaggaacaccatgcccgccgcctgcactacgacttccggctg
gaacgcgacggcgtgctggtcagttgggcagtgcccaagaacctgcccgacacaccgtcg
gtgaaccacctcgccgtgcacaccgaggaccacccgatggagtacctgaccttcgcgggt
gagatccccaggggcgagtacggcggcggcgaggtctacatctgggacaccggcacctac
gagaccgagaagttcagggacaacccgcccgacggcccggaccgcggcggcgaggtcatc
gtgacgctgcacggcgagaagatcgacggccggtacgcgctgatccagaccgacggcaag
aactggcttgcgcaccggatgaaggaccagcaacggcccaccgcggcggatctggcgccg
atgctgacgacccacggctctgtgcagcggctcaccaaggggcagtgggcttttgagggc
aagtgggacggataccgcttgctggtcgaggccgatcacggcaggttggcactgcgctcg
cgcaacggccgcgacgtcaccgccgagtacccgcagttgcaggcgctggccgccgacctc
gccgaccaccacgtgatcctcgacggggaggcggtggcgctcgacgagtcgggggtgccg
agtttccgggagatgcagaaccgggcccgctcgacccgggtcgagttctgggcgttcgac
attctgtttctcgacggccgatcgctgctgcgggccaagtacaccgaccgccgccgggtg
ttggaagcgctggccgacgggggtggactgatcgtgcccccgttgatcggcgccgacacc
ggggcggaggcgctggagaccgcgcgcaagaggggctgggagggtgtggtcgccaagaag
cgggactccacctaccagccgggcaggcggtcgtcgtcgtggatcaaggacaagctgtgg
aacacgcaggaggtggtgatcggcggctggcggcaaggcgagggtggacgcaccagcggg
atcggcgcgttgatgctcggcatccccgccggcggtgtggccggcggcctgcagttcgtc
ggccgcgtcggcacgggcttcaccgagaaggagctggcgtcgttgaaggagacgctggca
ccgctgcacaccgatgaatcacccttcgccacagagcttcccaagcaggacgcaaaaggc
gtgaccttcgtgcggcccgaactggtgggagaggtgcgctacagcgaacgcacctcggac
aaccggttgcggcagccgagctggcgcggactgcgcacggacaagacgcccgacgaggtg
gtctgggagtag

DBGET integrated database retrieval system