KEGG   Methanococcus vannielii: Mevan_0824Help
Entry
Mevan_0824        CDS       T00554                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
mvn  Methanococcus vannielii
Pathway
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mvn00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Mevan_0824
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Mevan_0824
Enzymes [BR:mvn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Mevan_0824
Peptidoglycan biosynthesis and degradation proteins [BR:mvn01011]
 Precursor biosynthesis
  Racemase
   Mevan_0824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
complement(853380..854522)
Genome map
AA seq 380 aa AA seqDB search
MISHPIWAEIDLNAVKNNIKEIRRITNSDSQIMAVVKANAYGHGAVEISKVVLKNGADRL
AVARSKEAIELRNAGFKCPILVFGYNTIEEILELIKNDVILTVYSIEIAKDIQKIAKDIQ
KIAKDIQKIAKVHLKIDTGMNRLGFIPDKKTINEILKISEFLNIEIEGIYTHFADADNSD
KTYTKKQFSKFMEFLTDLEDSGINIPIKHVSNSAAIIDHPETHLNMVRPGIILYGLYPSE
LVQKDKINLEPVMSLKCLITHVKDVPRGTKISYGCTYITKKKSKIASIPLGYADGFTRML
KNGKVLVGGKRAPIVGRICMDQCMADVSNIDDVKIGDTVLVFGKHEKYTVPVEEISNELK
TINYELVCMISNRVPRVYRY
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgatttcacatccaatatgggctgaaattgatttaaatgcagttaaaaataatattaaa
gaaataaggagaattacaaactcggattcccagataatggcagtagtaaaagcaaatgct
tatggacacggggcagttgaaatttcaaaagtagttttaaaaaacggtgccgataggctt
gctgttgcaagatcaaaagaagctattgaattaagaaatgcaggatttaaatgccctatt
ttagtctttggatataatacaatagaagaaattttggaactgattaaaaacgatgttata
ttaacagtttattctattgaaattgcaaaagacattcaaaagattgcaaaagacattcaa
aagattgcaaaagacattcaaaagattgcaaaagtacatttaaagatagataccggaatg
aatagacttggatttattcccgataaaaagactattaatgaaatattgaaaattagtgaa
tttttaaatatcgaaattgagggaatatatacacattttgcagatgcggataattctgat
aaaacgtatacaaaaaagcaattttcaaaatttatggaatttttgactgatttagaagat
tcgggaattaatattccaataaagcatgtatcaaacagtgcagcaataattgatcatccg
gaaactcatttaaacatggtaaggccgggaattattctttatgggctttatccatcggaa
ttagtccaaaaagataagattaatttagagcccgttatgagcttaaagtgcttgattaca
cacgtaaaagacgttccaaggggaacaaaaataagctatggctgtacatatattaccaaa
aaaaaatcaaaaattgcatctattcccttaggttatgcggatggatttacaaggatgtta
aagaatggaaaagtcctagttggtggaaaaagggcgccaattgttggacggatatgtatg
gatcagtgtatggcggatgtttccaatatagatgacgtaaaaattggcgatacagtactt
gtttttggaaaacatgaaaagtatactgttccagtagaagaaatttcaaacgaactaaaa
actataaattatgaactggtctgcatgatttctaaccgcgttccaagagtatatagatat
taa

DBGET integrated database retrieval system